BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_F08_e350_12.seq (1524 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g34660.1 68415.m04258 glutathione S-conjugate ABC transporter... 30 4.6 At4g04890.1 68417.m00712 homeobox-leucine zipper protein protode... 29 8.1 >At2g34660.1 68415.m04258 glutathione S-conjugate ABC transporter (MRP2) almost identical to MgATP-energized glutathione S-conjugate pump GI:2909781 from [Arabidopsis thaliana] Length = 1623 Score = 29.9 bits (64), Expect = 4.6 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 555 QDIVNGNRNDRQLTAHDNGQVTKGNKEKGSLIAAVIDQTDTPV 683 Q + NGN N Q+ D+ + +GNK+ G + ++ +T V Sbjct: 860 QPVANGNTNGLQMDGSDDKKSKEGNKKGGKSVLIKQEERETGV 902 >At4g04890.1 68417.m00712 homeobox-leucine zipper protein protodermal factor 2 (PDF2) identical to GP|14276060| protodermal factor2 (GI:14276060) Length = 743 Score = 29.1 bits (62), Expect = 8.1 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +3 Query: 243 LKLKFWTSN*VLNCETESYYHDNLILKCKKVLLFV*GN-FKSTINNLKC 386 L++KFW N + +S H+N ILK L N +K ++N C Sbjct: 104 LQVKFWFQNKRTQMKAQSERHENQILKSDNDKLRAENNRYKEALSNATC 152 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,136,040 Number of Sequences: 28952 Number of extensions: 350762 Number of successful extensions: 878 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 878 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4077124416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -