BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_F07_e342_11.seq (1494 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 5.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 5.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 9.0 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 5.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 349 LSFLVYRSSCYQLTKKSMWWSLVKKRLKTTDLDNR 245 L+FLVY S+ +L S+W L L LD++ Sbjct: 358 LAFLVYPSAVLELPGSSIWSCLFFFMLILIGLDSQ 392 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 5.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 349 LSFLVYRSSCYQLTKKSMWWSLVKKRLKTTDLDNR 245 L+FLVY S+ +L S+W L L LD++ Sbjct: 411 LAFLVYPSAVLELPGSSIWSCLFFFMLILIGLDSQ 445 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 9.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 527 NIDRWFPTSGPQEPIYGSRKISEFVRRSN 441 NI+R+F + P +YGS + E + SN Sbjct: 550 NIERFFKSKPPVATMYGSDE--EIINSSN 576 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 342,785 Number of Sequences: 438 Number of extensions: 7994 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 52156500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -