BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_F05_e326_11.seq (1607 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC887.09c |||leucine-rich repeat protein Sog2 |Schizosaccharom... 28 3.1 SPAC3G9.08 |png1||ING family homolog Png1|Schizosaccharomyces po... 28 4.2 >SPBC887.09c |||leucine-rich repeat protein Sog2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 886 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +3 Query: 273 LLYVVLATACYEIQSATLRFIPSRMGDANEVDEPEMR-SPAELVRARVG 416 LL ++L A E+Q+A + PS+ N + ++R SP ++R G Sbjct: 610 LLLLILFDAAKELQNALVPLSPSQPHSGNNIFADQVRQSPTSMIRTASG 658 >SPAC3G9.08 |png1||ING family homolog Png1|Schizosaccharomyces pombe|chr 1|||Manual Length = 283 Score = 27.9 bits (59), Expect = 4.2 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -2 Query: 475 TGPAGGDTHRPAHSGGGTPSPTRARTNSAGDRISGSST 362 + P GG + A S TP+P+R+ ++AG R + ++T Sbjct: 131 SSPYGGYSPSGASSARQTPAPSRSGASTAGRRRTSATT 168 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,152,247 Number of Sequences: 5004 Number of extensions: 76194 Number of successful extensions: 192 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 192 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 909817866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -