BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_F05_e326_11.seq (1607 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 24 4.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 7.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 7.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 7.4 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 9.8 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.8 bits (49), Expect = 4.2 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = -2 Query: 463 GGDTHRPAHSGGGTPSPTRARTNSAGDRISGSSTSLASPIRDGMN 329 G H P H+ G PS T A A GS + ASP G++ Sbjct: 209 GYGRHLPGHAQMGRPSYTTA--TMATTSTPGSGSLPASPADSGVS 251 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 99 NIQIHNTSIHNTYHIYALNSRT 164 N Q++ SIHN Y ++ T Sbjct: 578 NAQVNKRSIHNNYPVHTFGRLT 599 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 7.4 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 Query: 424 YHRHYAPDGACRPPP 468 YH H +G PPP Sbjct: 1742 YHEHAMTEGCASPPP 1756 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 7.4 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 Query: 424 YHRHYAPDGACRPPP 468 YH H +G PPP Sbjct: 1738 YHEHAMTEGCASPPP 1752 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.6 bits (46), Expect = 9.8 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 445 PAHSGGGTPSPTRARTNSAGDRISGSSTSLASPIRDGMN 329 P++ GGG+ SP+ + +S + S TSL S G++ Sbjct: 81 PSYPGGGSSSPSPSSPSSFFSSV--SPTSLGSENYTGIS 117 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 303,744 Number of Sequences: 438 Number of extensions: 6892 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 56702250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -