BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_F04_e318_12.seq (1602 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0431 - 18152041-18152085,18152368-18152685,18152927-181534... 31 3.4 >07_03_0431 - 18152041-18152085,18152368-18152685,18152927-18153482, 18153886-18154577,18155234-18155614,18156159-18156241, 18156618-18156786,18157498-18157543,18158301-18158389, 18158476-18158591,18159137-18159443 Length = 933 Score = 30.7 bits (66), Expect = 3.4 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 3/66 (4%) Frame = +1 Query: 592 ASQQSANGAMAPTNVINTGM-SLSNPVMNSTANLNTT--GLLGANQIHGGSPNLLGSQTK 762 +SQQ NG N++NT M S + P +N + T GL N H G+ G QT+ Sbjct: 248 SSQQINNGPKNSGNIVNTSMASNAIPALNVVSETYATNHGLNQVNANHFGALKHQGDQTQ 307 Query: 763 GVELDD 780 + D Sbjct: 308 SLLASD 313 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,434,620 Number of Sequences: 37544 Number of extensions: 540129 Number of successful extensions: 1338 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1338 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 5197744384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -