BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_F04_e318_12.seq (1602 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39999-3|AAR85904.2| 114|Caenorhabditis elegans Insulin related... 30 5.3 Z81575-5|CAB04631.2| 353|Caenorhabditis elegans Hypothetical pr... 29 9.2 >U39999-3|AAR85904.2| 114|Caenorhabditis elegans Insulin related protein 15 protein. Length = 114 Score = 29.9 bits (64), Expect = 5.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 365 VSCEVLFIVCCCEEGATDDAVFARCSARK 279 + E+L + CC G TD +F+ C RK Sbjct: 55 IQTEILRALDCCSTGCTDKQIFSWCDFRK 83 >Z81575-5|CAB04631.2| 353|Caenorhabditis elegans Hypothetical protein R08H2.5 protein. Length = 353 Score = 29.1 bits (62), Expect = 9.2 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -3 Query: 571 LVDHFACKAYCWCYCLYLFSTKSTSWRLCRPAVEKCHVLLVKIL 440 ++ HF C YC+YLF +K S + EK LV +L Sbjct: 222 VIGHFLFHMVCLVYCIYLFPSKVVS----KETQEKQKTFLVSVL 261 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,819,634 Number of Sequences: 27780 Number of extensions: 443822 Number of successful extensions: 1148 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1075 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1148 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4649746304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -