BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_F03_e310_11.seq (1602 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 23 6.3 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 8.3 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 23 8.3 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 23.0 bits (47), Expect = 6.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 260 IRIILFRFLQVISISQVKKMK*GSYYILQFLIY 358 IR + F + S+ +VK+M YY+L L Y Sbjct: 16 IRDLSLYFSVIYSLLRVKRMMRSWYYLLTNLTY 48 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.6 bits (46), Expect = 8.3 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 665 DF-YLIHIYINIETKKTITSLLFKIQFHWNDSCQTNS 558 DF YL +I KK LFK H++ CQ NS Sbjct: 85 DFAYLETTWICTLLKKDKLLELFKRLIHFDTKCQENS 121 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 22.6 bits (46), Expect = 8.3 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 665 DF-YLIHIYINIETKKTITSLLFKIQFHWNDSCQTNS 558 DF YL +I KK LFK H++ CQ NS Sbjct: 103 DFAYLETTWICTLLKKDKLLELFKRLIHFDTKCQENS 139 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 260,070 Number of Sequences: 336 Number of extensions: 5440 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 48447025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -