BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 030723E4_F02_e302_12.seq
(1562 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_O84880 Cluster: Probable outer membrane protein pmpH pr... 36 3.8
>UniRef50_O84880 Cluster: Probable outer membrane protein pmpH
precursor; n=21; Chlamydia|Rep: Probable outer membrane
protein pmpH precursor - Chlamydia trachomatis
Length = 1016
Score = 35.5 bits (78), Expect = 3.8
Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
Frame = +2
Query: 224 NKSSLNYSGDNLLT*HNLHTDIPSTNSRGPLRTNPFFISAS*YFTANEYQSL-HNQNIFC 400
N S ++ +GDNL HT + T+S+GP+ N FISA T ++ SL ++N+ C
Sbjct: 60 NGSIISANGDNLTITGQNHT-LSFTDSQGPVLQNYAFISAGETLTLKDFSSLMFSKNVSC 118
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 764,507,815
Number of Sequences: 1657284
Number of extensions: 13350128
Number of successful extensions: 22766
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 21930
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22756
length of database: 575,637,011
effective HSP length: 104
effective length of database: 403,279,475
effective search space used: 167764261600
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -