BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_F02_e302_12.seq (1562 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81478-1|CAB03932.1| 199|Caenorhabditis elegans Hypothetical pr... 32 1.3 Z70783-10|CAC70122.1| 1037|Caenorhabditis elegans Hypothetical p... 30 5.1 >Z81478-1|CAB03932.1| 199|Caenorhabditis elegans Hypothetical protein C31G12.1 protein. Length = 199 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -1 Query: 260 TSYRLNSLSLIY*NIRFIVCRNIEFCDNES 171 T +RLNSLSL+ I+C N CDN S Sbjct: 75 TVWRLNSLSLVACGFFTIICANQYICDNHS 104 >Z70783-10|CAC70122.1| 1037|Caenorhabditis elegans Hypothetical protein ZK856.13 protein. Length = 1037 Score = 29.9 bits (64), Expect = 5.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 541 LLTGNFRYFSGRYSKVWVEISRNVIESHLIS 449 L+TG +R+ G Y +VWV RN + L++ Sbjct: 886 LITGTYRHAMGEYLRVWVANKRNPLICMLLA 916 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,908,599 Number of Sequences: 27780 Number of extensions: 326604 Number of successful extensions: 566 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4514820630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -