BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_E12_e381_10.seq (1548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 5.3 L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein pro... 23 9.3 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 9.3 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 5.3 Identities = 17/70 (24%), Positives = 28/70 (40%) Frame = +1 Query: 568 LTVSESDAFSSPLNSPLTHTLRTTRARPLVTYRGSRPPPPNTLQRAAPLXXXXXXXXXXV 747 L V++ A P S + T + L T S+PPP + + +P+ Sbjct: 344 LHVAKQMASPEPPKSSESSTGSSIPKLNLSTALMSQPPPNFGVSQVSPVSMSALVSAVRS 403 Query: 748 HSNGPAPPSS 777 + G PPS+ Sbjct: 404 PAGGQLPPSA 413 >L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein protein. Length = 74 Score = 22.6 bits (46), Expect = 9.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 Query: 488 RRRTEVHTGDRP 523 RR VHTG+RP Sbjct: 54 RRHLRVHTGERP 65 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.6 bits (46), Expect = 9.3 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 131 LMLKHVKIAPLILTTP 84 L LKH++ A L+LT P Sbjct: 64 LNLKHLRAAVLVLTNP 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 343,269 Number of Sequences: 438 Number of extensions: 7437 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 54309750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -