BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_E10_e365_10.seq (1547 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 89 9e-18 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 52 9e-07 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) 49 9e-06 SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-05 SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 46 6e-05 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) 46 6e-05 SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 8e-04 SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 42 0.001 SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 42 0.001 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) 41 0.002 SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) 41 0.003 SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.003 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 40 0.004 SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) 40 0.004 SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) 40 0.005 SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 40 0.005 SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) 39 0.012 SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) 38 0.016 SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) 38 0.029 SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) 33 0.61 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.61 SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.61 SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) 32 1.1 SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.3 SB_9716| Best HMM Match : HMG_box (HMM E-Value=0.0041) 29 7.6 SB_56838| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 10.0 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 89.0 bits (211), Expect = 9e-18 Identities = 37/77 (48%), Positives = 51/77 (66%) Frame = +3 Query: 135 KKNKMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKDKSIWXXXX 314 KK K + PKR MSAYMLWLN R++IK ++PG+ VTE++K GEMWK++ DKS W Sbjct: 534 KKKKDPNAPKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWEEKA 593 Query: 315 XXXXXQYAKDLESYNAN 365 +Y + ++ YN N Sbjct: 594 AIEKQKYVQRMKEYNEN 610 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 52.4 bits (120), Expect = 9e-07 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 2/77 (2%) Frame = +3 Query: 132 RKKNKMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM--KDKSIWX 305 +K +K + PK P++ Y+ +LN RE+++SE+P L E+ + G MW + K ++ Sbjct: 168 KKAHKDVNAPKAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQLPTPQKQLFL 227 Query: 306 XXXXXXXXQYAKDLESY 356 +Y K+LE Y Sbjct: 228 EEAEKDKERYMKELEEY 244 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 49.6 bits (113), Expect = 7e-06 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 5/80 (6%) Frame = +3 Query: 132 RKKNKMTDKPKRPMSAYMLW---LNSAREQIKSEHPGLKVTEIAKKGGEMWKSM--KDKS 296 RKK +KPK P++ Y+ + LNS RE +K +HP L EI K G+ W S+ ++K Sbjct: 185 RKKEYDLNKPKAPVTGYVHYVRFLNSRRESVKHQHPHLTFPEITKMLGQEWNSLLPEEKQ 244 Query: 297 IWXXXXXXXXXQYAKDLESY 356 + +Y ++L +Y Sbjct: 245 KFLDEAEEDKKRYVEELRAY 264 >SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) Length = 398 Score = 49.2 bits (112), Expect = 9e-06 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 2/56 (3%) Frame = +3 Query: 129 IRKKNKMTDKP--KRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKD 290 +R T KP KRPM+A+M+W +AR ++ ++P L E++K G++WK + D Sbjct: 52 VRVNGIKTQKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWKLLND 107 >SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 46.8 bits (106), Expect = 5e-05 Identities = 20/53 (37%), Positives = 32/53 (60%) Frame = +3 Query: 132 RKKNKMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKD 290 +K+ K +KPKR +SAY ++N R+ +K ++P ++K GEMW M D Sbjct: 93 KKQTKDPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTD 145 Score = 39.1 bits (87), Expect = 0.009 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = +3 Query: 144 KMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM--KDKSIWXXXXX 317 K +KPK SAY +L RE+++ E + + +K E WK+M ++K + Sbjct: 7 KDPNKPKGAKSAYNFFLQDQREKLQREEGKFSLADFSKVSAEKWKNMSEEEKETFVQKAG 66 Query: 318 XXXXQYAKDLESY 356 ++ ++++SY Sbjct: 67 KDKERFKEEMQSY 79 >SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 46.4 bits (105), Expect = 6e-05 Identities = 19/52 (36%), Positives = 30/52 (57%) Frame = +3 Query: 135 KKNKMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKD 290 KK KRPM+A+M+W R ++ EHP + EI+K+ G+ WK + + Sbjct: 37 KKKSDMQHVKRPMNAFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLLSE 88 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 46.4 bits (105), Expect = 6e-05 Identities = 19/75 (25%), Positives = 42/75 (56%), Gaps = 2/75 (2%) Frame = +3 Query: 132 RKKNKMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM--KDKSIWX 305 ++K K+ +P +P+SAY ++ + I+ ++P + EIAK G+MW+++ + K ++ Sbjct: 916 KRKTKIEGEPPKPLSAYQIFFKETQAAIRLQNPSAQFGEIAKIVGQMWENLPEEQKKVYH 975 Query: 306 XXXXXXXXQYAKDLE 350 +Y K ++ Sbjct: 976 CKHETAKAEYQKAMD 990 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 46.4 bits (105), Expect = 6e-05 Identities = 19/49 (38%), Positives = 30/49 (61%) Frame = +3 Query: 144 KMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKD 290 K + KRPM+A+M+W R +I E+P + +EI+K+ G WK + D Sbjct: 322 KPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLAD 370 >SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) Length = 179 Score = 46.4 bits (105), Expect = 6e-05 Identities = 19/49 (38%), Positives = 30/49 (61%) Frame = +3 Query: 144 KMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKD 290 K + KRPM+A+M+W R +I E+P + +EI+K+ G WK + D Sbjct: 5 KPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLAD 53 >SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 44.8 bits (101), Expect = 2e-04 Identities = 17/52 (32%), Positives = 32/52 (61%) Frame = +3 Query: 138 KNKMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKDK 293 K D+ KRPM+A+M+W R ++ ++P + +EI+K+ G WK + ++ Sbjct: 782 KANSADRVKRPMNAFMVWSRERRRKMAQDNPKMHNSEISKRLGSEWKLLSEQ 833 >SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 44.4 bits (100), Expect = 2e-04 Identities = 16/47 (34%), Positives = 31/47 (65%) Frame = +3 Query: 144 KMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM 284 K K KRPM+++M+W SAR ++ ++P + E++K G++W+ + Sbjct: 106 KKDPKVKRPMNSFMVWAQSARRKLAEQYPHVHNAELSKMLGKLWRML 152 >SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.7 bits (96), Expect = 8e-04 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +3 Query: 144 KMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM 284 K D KRPM+AYM+W R +I E P + +EI+K+ G W S+ Sbjct: 3 KPGDHIKRPMNAYMVWSRKERRRIAEECPRMLNSEISKRLGLEWNSL 49 >SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 267 Score = 42.3 bits (95), Expect = 0.001 Identities = 16/41 (39%), Positives = 28/41 (68%) Frame = +3 Query: 162 KRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM 284 KRPM+A+M+W + R Q+ +E+P L ++I+K G W+ + Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKL 48 >SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 494 Score = 42.3 bits (95), Expect = 0.001 Identities = 16/41 (39%), Positives = 28/41 (68%) Frame = +3 Query: 162 KRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM 284 KRPM+A+M+W + R Q+ +E+P L ++I+K G W+ + Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKL 48 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/45 (48%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +3 Query: 162 KRPMSAYMLWLNSAREQIKS-EHPGLKVTEIAKKGGEMWKSMKDK 293 KRPM+A+M+W + R +IKS E P + +EI+K G WK+MKD+ Sbjct: 10 KRPMNAFMVW-SKERRRIKSQECPRMHNSEISKILGCEWKAMKDE 53 >SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) Length = 406 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%) Frame = +3 Query: 60 AGNSARGYSLVVHQFKNNFKIFAIRKKNKMTDKPKRPMSAYMLWLNSAREQIKSEHPGLK 239 + + AR + Q K N +I A R K D+ + + + LWL R+QI+ E+P + Sbjct: 297 SNSKARKSKQMTLQSKVNNQIKADRPDEK-ADRQTKKKNGFSLWLEENRDQIEEENPDIP 355 Query: 240 VTEIAKKGGEMWKSMK--DKSIW 302 ++ K + WK + +K +W Sbjct: 356 DEDVVKIAMKTWKGLDSVEKKVW 378 >SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) Length = 245 Score = 40.7 bits (91), Expect = 0.003 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +3 Query: 153 DKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKD 290 D KRP++++M+W R + E+P ++ EI+K G+ W+ M + Sbjct: 8 DHVKRPLNSFMVWAKEKRRAMNRENPKMRNAEISKILGDEWRKMPE 53 >SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/50 (32%), Positives = 31/50 (62%) Frame = +3 Query: 135 KKNKMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM 284 +K+ T++ KRPM+A+M+W R ++ +P L E++K G W+++ Sbjct: 358 EKDDETERIKRPMNAFMVWAQVERRRLADANPELHNAELSKMLGLTWRAL 407 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +3 Query: 162 KRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM--KDKSIWXXXXXXXXXQY 335 KRPM+++M+W R + E+P L EI+K G+ W + KDK + ++ Sbjct: 95 KRPMNSFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTKDKRPFVEKAERLRIRH 154 Query: 336 AKDLESY 356 K+ +Y Sbjct: 155 MKEHPNY 161 >SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) Length = 324 Score = 40.3 bits (90), Expect = 0.004 Identities = 14/44 (31%), Positives = 28/44 (63%) Frame = +3 Query: 159 PKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKD 290 P++P+ YM + +Q+K+++P K+ +I K G+MW+ + D Sbjct: 28 PEKPLMPYMRYSRKVWDQVKNQNPDFKLWDIGKIIGQMWRDLDD 71 >SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) Length = 299 Score = 39.9 bits (89), Expect = 0.005 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 2/73 (2%) Frame = +3 Query: 138 KNKMTDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM--KDKSIWXXX 311 KNK + + P+SA+ LW N AR+ + +P + ++ KK WK + K K W Sbjct: 221 KNKYPNV-EPPLSAFELWANQARKDLLVSNPDISAKKLKKKLKRKWKEIDEKGKKTWIKK 279 Query: 312 XXXXXXQYAKDLE 350 +Y K ++ Sbjct: 280 EKTEMRKYQKKIK 292 Score = 39.5 bits (88), Expect = 0.007 Identities = 14/47 (29%), Positives = 29/47 (61%) Frame = +3 Query: 153 DKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKDK 293 ++PK P+++Y + R ++ ++P LK TE+A K + W+ M ++ Sbjct: 150 NQPKMPLTSYFRYCQKHRAKLAKKYPNLKSTELAAKLSKKWRKMSEE 196 >SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 39.9 bits (89), Expect = 0.005 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +3 Query: 162 KRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM 284 KRPM+ +M+W R QI E+PG+ ++K G WK + Sbjct: 9 KRPMNCFMVWSREKRCQILQENPGINNARLSKLLGMAWKKL 49 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 39.9 bits (89), Expect = 0.005 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 4/75 (5%) Frame = +3 Query: 144 KMTDKPKRPMSAYMLWLNSAREQI--KSEHPGLKVTEIAKKGGEMWKSM--KDKSIWXXX 311 K DKPKRP +AY L+L + R+++ K+ G K+ +A GE W+ M +DK + Sbjct: 572 KDPDKPKRPPTAYFLFLAAFRKEMAGKALEDGKKIPSLA---GERWREMSDEDKKPYTIQ 628 Query: 312 XXXXXXQYAKDLESY 356 +Y K +E + Sbjct: 629 EAEERNKYEKVMEEW 643 Score = 35.1 bits (77), Expect = 0.15 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 7/61 (11%) Frame = +3 Query: 132 RKKNKMTDKP--KRPMSAYMLWLNSAREQIKSEH-----PGLKVTEIAKKGGEMWKSMKD 290 RKK D P KR SAY+ + + R ++K++ P K E+AK GE WK + D Sbjct: 485 RKKKAKGDGPVVKRASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLND 544 Query: 291 K 293 + Sbjct: 545 E 545 >SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +3 Query: 156 KPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKDK 293 K KRPM+A+M+W R I +P EI+ + GE+W + + Sbjct: 100 KVKRPMNAFMIWARLHRSTIAKRYPQANNAEISIRLGEIWNDLSSE 145 >SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) Length = 245 Score = 38.7 bits (86), Expect = 0.012 Identities = 15/48 (31%), Positives = 31/48 (64%) Frame = +3 Query: 150 TDKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKDK 293 ++K KRP++A++LW R I +E+P + +I++K G W+ + ++ Sbjct: 16 SEKIKRPLNAFILWSKKRRRVIANENPQMHNFDISRKLGLEWQKLTEE 63 >SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) Length = 200 Score = 38.3 bits (85), Expect = 0.016 Identities = 21/75 (28%), Positives = 37/75 (49%) Frame = +3 Query: 60 AGNSARGYSLVVHQFKNNFKIFAIRKKNKMTDKPKRPMSAYMLWLNSAREQIKSEHPGLK 239 + + AR + Q K N +I A R K D+ + + + LWL R+QI+ E+P + Sbjct: 4 SNSKARKSKQMTLQSKVNNQIKADRPDEK-ADRQTKKKNGFSLWLEENRDQIEEENPDIP 62 Query: 240 VTEIAKKGGEMWKSM 284 ++ K + WK + Sbjct: 63 DEDVVKIAMKTWKGL 77 >SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) Length = 201 Score = 37.5 bits (83), Expect = 0.029 Identities = 14/44 (31%), Positives = 27/44 (61%) Frame = +3 Query: 162 KRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKDK 293 KRPM+A+M+W + R ++ ++P + EI+K G W + ++ Sbjct: 10 KRPMNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRLSEE 53 >SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) Length = 145 Score = 33.1 bits (72), Expect = 0.61 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 162 KRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKS 281 KR S Y+L+ + R I+ EHP EI++ GE W++ Sbjct: 36 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRN 75 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 33.1 bits (72), Expect = 0.61 Identities = 18/69 (26%), Positives = 32/69 (46%) Frame = +3 Query: 156 KPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSMKDKSIWXXXXXXXXXQY 335 K KRP A+ + +++K E+P LK EI K + W +++ +Y Sbjct: 305 KHKRPTPAFFRFRQDYADKVKEENPHLKDAEIRKHLSDQWANLEP-----SVKECYRKEY 359 Query: 336 AKDLESYNA 362 +D+E + A Sbjct: 360 QQDMEEFRA 368 >SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 33.1 bits (72), Expect = 0.61 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 162 KRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKS 281 KR S Y+L+ + R I+ EHP EI++ GE W++ Sbjct: 1269 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRN 1308 >SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) Length = 271 Score = 32.3 bits (70), Expect = 1.1 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +3 Query: 162 KRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM 284 K PM+A+M+ R+ S +PG+ +E +K G WK + Sbjct: 10 KSPMNAFMVCSRGKRKHYASINPGMHNSEFSKSLGPEWKML 50 >SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 30.7 bits (66), Expect = 3.3 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +3 Query: 153 DKPKRPMSAYMLWLNSAREQIKSEHPGLKVTEIAKKGGEMWKSM 284 D +RPM+A+M++ R + +HP ++K GE W ++ Sbjct: 514 DHIRRPMNAFMIFSKRHRALVHQKHPHQDNRTVSKILGEWWYAL 557 >SB_9716| Best HMM Match : HMG_box (HMM E-Value=0.0041) Length = 169 Score = 29.5 bits (63), Expect = 7.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 162 KRPMSAYMLWLNSAREQIKSEHPG 233 KRPM+A+ML+ R +I HPG Sbjct: 32 KRPMNAFMLFAKRYRLEITQAHPG 55 >SB_56838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 29.1 bits (62), Expect = 10.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 901 VRWDFXDAHFKINWPGFIXPCXSSQLFFHG 990 V W F +A F W G + C S QLF+ G Sbjct: 270 VTWGFVNALFHFLWVGALFICQSYQLFWIG 299 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,337,103 Number of Sequences: 59808 Number of extensions: 548650 Number of successful extensions: 1051 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 978 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1045 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5047244110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -