BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_E08_e349_10.seq (1528 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 2e-17 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 87 3e-17 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 87 3e-17 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 87 3e-17 SB_56655| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 1e-11 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 9e-11 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 64 4e-10 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-09 SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) 60 3e-09 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 6e-09 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 59 8e-09 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 8e-09 SB_48121| Best HMM Match : Kelch_1 (HMM E-Value=0.023) 59 8e-09 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 59 8e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 8e-09 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) 58 2e-08 SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) 58 2e-08 SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 3e-08 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 57 3e-08 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_26951| Best HMM Match : CUB (HMM E-Value=0) 57 4e-08 SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 56 7e-08 SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 7e-08 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 56 1e-07 SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-07 SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) 55 1e-07 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 2e-07 SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) 54 2e-07 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 54 3e-07 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56401| Best HMM Match : Moricin (HMM E-Value=5.8) 54 4e-07 SB_43571| Best HMM Match : Ank (HMM E-Value=3e-34) 54 4e-07 SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) 54 4e-07 SB_39465| Best HMM Match : PDH (HMM E-Value=1.5) 54 4e-07 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) 54 4e-07 SB_42228| Best HMM Match : Moricin (HMM E-Value=6.6) 54 4e-07 SB_39908| Best HMM Match : Prismane (HMM E-Value=3) 54 4e-07 SB_37382| Best HMM Match : Pkinase (HMM E-Value=1e-04) 54 4e-07 SB_37193| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) 54 4e-07 SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) 54 4e-07 SB_41709| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 5e-07 SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) 53 5e-07 SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 5e-07 SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) 53 5e-07 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 7e-07 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 53 7e-07 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 9e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 50 4e-06 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 5e-06 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 5e-06 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 50 7e-06 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 50 7e-06 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 50 7e-06 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 50 7e-06 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_51067| Best HMM Match : UPF0126 (HMM E-Value=1.4) 50 7e-06 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 50 7e-06 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 50 7e-06 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 50 7e-06 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 50 7e-06 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 50 7e-06 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 50 7e-06 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 50 7e-06 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 50 7e-06 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 50 7e-06 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 50 7e-06 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 50 7e-06 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 50 7e-06 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 50 7e-06 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 50 7e-06 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 50 7e-06 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 50 7e-06 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 50 7e-06 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 50 7e-06 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 50 7e-06 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 50 7e-06 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 50 7e-06 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 50 7e-06 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 50 7e-06 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 50 7e-06 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 50 7e-06 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 50 7e-06 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 50 7e-06 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 50 7e-06 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 50 7e-06 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 50 7e-06 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 50 7e-06 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 50 7e-06 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 50 7e-06 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 50 7e-06 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 50 7e-06 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 50 7e-06 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 50 7e-06 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 50 7e-06 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 50 7e-06 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 50 7e-06 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 50 7e-06 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 50 7e-06 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 50 7e-06 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 50 7e-06 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 50 7e-06 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 50 7e-06 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 50 7e-06 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 50 7e-06 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 50 7e-06 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 50 7e-06 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 50 7e-06 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 50 7e-06 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-06 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 50 7e-06 SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 9e-06 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 49 1e-05 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 48 2e-05 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 48 2e-05 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 48 2e-05 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 48 2e-05 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 48 2e-05 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 48 2e-05 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 48 2e-05 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 48 2e-05 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 48 2e-05 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 48 2e-05 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 48 2e-05 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 48 2e-05 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 48 2e-05 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 48 2e-05 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 48 2e-05 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 48 2e-05 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 48 2e-05 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 48 2e-05 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 48 2e-05 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 48 2e-05 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 48 2e-05 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 48 2e-05 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 48 2e-05 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 48 2e-05 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 87.8 bits (208), Expect = 2e-17 Identities = 37/41 (90%), Positives = 37/41 (90%) Frame = -2 Query: 927 QLAKGECAARRXSWVRQGFPSHDVVKRRPVNCNTTHYRANW 805 QLAKG CAARR SWV GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 40 QLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 87.4 bits (207), Expect = 3e-17 Identities = 42/63 (66%), Positives = 42/63 (66%) Frame = -2 Query: 993 HXPXRLRKXXXXXXXXXXXXLXQLAKGECAARRXSWVRQGFPSHDVVKRRPVNCNTTHYR 814 H P RLR L QLAKG CAARR SW GFPSHDVVKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 645 Query: 813 ANW 805 ANW Sbjct: 646 ANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 87.4 bits (207), Expect = 3e-17 Identities = 42/63 (66%), Positives = 42/63 (66%) Frame = -2 Query: 993 HXPXRLRKXXXXXXXXXXXXLXQLAKGECAARRXSWVRQGFPSHDVVKRRPVNCNTTHYR 814 H P RLR L QLAKG CAARR SW GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 813 ANW 805 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 87.4 bits (207), Expect = 3e-17 Identities = 42/63 (66%), Positives = 42/63 (66%) Frame = -2 Query: 993 HXPXRLRKXXXXXXXXXXXXLXQLAKGECAARRXSWVRQGFPSHDVVKRRPVNCNTTHYR 814 H P RLR L QLAKG CAARR SW GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 813 ANW 805 ANW Sbjct: 89 ANW 91 >SB_56655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 68.9 bits (161), Expect = 1e-11 Identities = 31/59 (52%), Positives = 41/59 (69%) Frame = +1 Query: 148 EAFFDEYDYYNFDHDKHIFTGHGGKQRTKREATEHTNHFDPSGHSRKIVTKLVNTENNK 324 E +FDEYDYYNFD +++ G+ K R+KREA +TN F P GH RK++ K NTE N+ Sbjct: 2 EPYFDEYDYYNFD--RNVVEGNTRKGRSKREACLNTNRFCPGGHERKVLEKYRNTEKNR 58 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 65.7 bits (153), Expect = 9e-11 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 882 RQGFPSHDVVKRRPVNCNTTHYRANW 805 RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 77 RQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 1003 SNLPXXXQAAQTVGXGDRWGLFAITPAGERG 911 S+LP QAAQ +G GLFAITPAGE+G Sbjct: 37 SDLPS--QAAQLLGRAIGAGLFAITPAGEKG 65 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 64.1 bits (149), Expect = 3e-10 Identities = 27/32 (84%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 897 RXSWV-RQGFPSHDVVKRRPVNCNTTHYRANW 805 R W R GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 49 RNCWEGRSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 63.7 bits (148), Expect = 4e-10 Identities = 36/63 (57%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = +1 Query: 784 TRGGARYPIRPIVSRITIHWPAFYNVVTGKTLAYPTXSPCSTF-PFRQLX**RXGPTDRX 960 T GGA PIRPIVSRITIHWPAFYN TGKTLAY + + PF + DR Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRP 91 Query: 961 SQQ 969 SQQ Sbjct: 92 SQQ 94 Score = 46.4 bits (105), Expect = 6e-05 Identities = 22/37 (59%), Positives = 23/37 (62%) Frame = +2 Query: 884 TQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXW 994 TQL RLAAH PFASW NS+ A LRSL G W Sbjct: 66 TQLNRLAAHPPFASWRNSQEARADRPSQQLRSLNGEW 102 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 62.5 bits (145), Expect = 9e-10 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -2 Query: 918 KGECAARRXSWVRQGFPSHDVVKRRPVNCNTTHYRANW 805 +G C +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 RGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 59.3 bits (137), Expect = 8e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 970 TVGXGDRWGLFAITPAGERGMCCKAXKLG 884 TVG GDR GLFAITPAGERGMCCKA KLG Sbjct: 4 TVGKGDRCGLFAITPAGERGMCCKAIKLG 32 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 876 GFPSHDVVKRRPVNCNTTHYRANW 805 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) Length = 1270 Score = 60.5 bits (140), Expect = 3e-09 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTPGFSQSRR 857 +P QAAQ +G GLFAITPAGERGMCCKA KL TP ++R+ Sbjct: 1122 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLDTPSSPRARK 1168 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 59.7 bits (138), Expect = 6e-09 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -2 Query: 918 KGECAARRXSWVRQGFPSHDVVKRRPVNCNTTHYRANW 805 +G C + V FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1863 RGMCC-KAIKLVTPVFPSHDVVKRRPVNCNTTHYRANW 1899 Score = 58.4 bits (135), Expect = 1e-08 Identities = 28/42 (66%), Positives = 30/42 (71%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTPGF 872 +P QAAQ +G GLFAITPAGERGMCCKA KL TP F Sbjct: 1836 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTPVF 1877 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 59.3 bits (137), Expect = 8e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 873 FPSHDVVKRRPVNCNTTHYRANW 805 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 39 FPSHDVVKRRPVNCNTTHYRANW 61 Score = 50.0 bits (114), Expect = 5e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -1 Query: 982 QAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 QAAQ +G GLFAITPAGERGMCCK+ KL Sbjct: 2 QAAQLLGRAIGAGLFAITPAGERGMCCKSIKL 33 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 59.3 bits (137), Expect = 8e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 873 FPSHDVVKRRPVNCNTTHYRANW 805 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_48121| Best HMM Match : Kelch_1 (HMM E-Value=0.023) Length = 1169 Score = 59.3 bits (137), Expect = 8e-09 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = -1 Query: 1021 LTKYNASNLPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 L KY+ +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 723 LWKYDIGRVPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 767 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 59.3 bits (137), Expect = 8e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 873 FPSHDVVKRRPVNCNTTHYRANW 805 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 31 FPSHDVVKRRPVNCNTTHYRANW 53 Score = 47.6 bits (108), Expect = 3e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -1 Query: 946 GLFAITPAGERGMCCKAXKLG 884 GLFAITPAGERGMCCKA KLG Sbjct: 6 GLFAITPAGERGMCCKAIKLG 26 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 59.3 bits (137), Expect = 8e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 873 FPSHDVVKRRPVNCNTTHYRANW 805 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 45 FPSHDVVKRRPVNCNTTHYRANW 67 Score = 56.0 bits (129), Expect = 7e-08 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLG 884 +P QAAQ +G GLFAITPAGERGMCCKA KLG Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLG 40 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 58.4 bits (135), Expect = 1e-08 Identities = 30/54 (55%), Positives = 32/54 (59%) Frame = +2 Query: 839 TGRRFTTS*LGKPWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 TGRRFT P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 58.4 bits (135), Expect = 1e-08 Identities = 31/52 (59%), Positives = 31/52 (59%) Frame = -2 Query: 993 HXPXRLRKXXXXXXXXXXXXLXQLAKGECAARRXSWVRQGFPSHDVVKRRPV 838 H P RLR L QLAKG CAARR SW GFPSHDVVKRRPV Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPV 67 >SB_55415| Best HMM Match : Death (HMM E-Value=1.3e-06) Length = 799 Score = 58.0 bits (134), Expect = 2e-08 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGT 881 +P QAAQ +G GLFAITPAGERGMCCKA KLGT Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGT 41 >SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) Length = 340 Score = 57.6 bits (133), Expect = 2e-08 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTPG 875 +P QAAQ +G GLFAITPAGERGMCCKA KLG G Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGVNG 43 >SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 57.2 bits (132), Expect = 3e-08 Identities = 27/44 (61%), Positives = 29/44 (65%) Frame = -1 Query: 1009 NASNLPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTP 878 N +P QAAQ +G GLFAITPAGERGMCCKA KL P Sbjct: 27 NCGRVPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVEP 70 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 57.2 bits (132), Expect = 3e-08 Identities = 30/52 (57%), Positives = 31/52 (59%) Frame = -1 Query: 994 PXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTPGFSQSRRCKTPAS 839 P QAAQ +G GLFAITPAGERGMCCKA KLG KT AS Sbjct: 11 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTFKTTAS 62 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 56.8 bits (131), Expect = 4e-08 Identities = 29/57 (50%), Positives = 34/57 (59%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTPGFSQSRRCKTPASEL*Y 827 +P QAAQ +G GLFAITPAGERGMCCKA KLG Q+ + P + Y Sbjct: 1945 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGRCPVQQNIQTLIPECNVQY 2001 >SB_26951| Best HMM Match : CUB (HMM E-Value=0) Length = 794 Score = 56.8 bits (131), Expect = 4e-08 Identities = 27/42 (64%), Positives = 29/42 (69%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTPGF 872 +P QAAQ +G GLFAITPAGERGMCCKA KLG F Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGLIAF 44 >SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1311 Score = 56.4 bits (130), Expect = 6e-08 Identities = 28/42 (66%), Positives = 30/42 (71%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTPGF 872 +P QAAQ +G GLFAITPAGERGMCCKA KL PGF Sbjct: 111 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL-EPGF 151 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 56.0 bits (129), Expect = 7e-08 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLG 884 +P QAAQ +G GLFAITPAGERGMCCKA KLG Sbjct: 119 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLG 156 >SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 56.0 bits (129), Expect = 7e-08 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLG 884 +P QAAQ +G GLFAITPAGERGMCCKA KLG Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLG 40 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 55.6 bits (128), Expect = 1e-07 Identities = 30/53 (56%), Positives = 33/53 (62%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTPGFSQSRRCKTPAS 839 +P QAAQ +G GLFAITPAGERGMCCKA KL S S C+ AS Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLDVDECSSS-PCQNGAS 54 >SB_2571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 55.6 bits (128), Expect = 1e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -1 Query: 982 QAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTP 878 QAAQ +G GLFAITPAGERGMCCKA KLG P Sbjct: 232 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGFP 266 >SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) Length = 1283 Score = 55.2 bits (127), Expect = 1e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -1 Query: 994 PXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTP 878 P QAAQ +G GLFAITPAGERGMCCKA KL P Sbjct: 11 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLDLP 49 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 55.2 bits (127), Expect = 1e-07 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = -1 Query: 1021 LTKYNASNLPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 LT +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 3076 LTPEKYGRVPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 3120 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 54.8 bits (126), Expect = 2e-07 Identities = 29/55 (52%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +1 Query: 808 IRPIVSRITIHWPAFYNVVTGKTLAYPTXSPCSTFPFRQL-X**RXGPTDRXSQQ 969 +RP+VSRITIHW +FYNVVTGKTLA P P TDR SQQ Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQ 87 >SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 54.4 bits (125), Expect = 2e-07 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGT 881 +P QAAQ +G GLFAITPAGERGMCCKA KL T Sbjct: 76 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVT 114 >SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) Length = 173 Score = 54.4 bits (125), Expect = 2e-07 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGT 881 +P QAAQ +G GLFAITPAGERGMCCKA KL T Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVT 41 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 54.4 bits (125), Expect = 2e-07 Identities = 29/53 (54%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +1 Query: 814 PIVSRITIHWPAFYNVVTGKTLAYPTXSPCSTFPFRQLX**R-XGPTDRXSQQ 969 P +SRITIHWP+FYNVVTGKTLA P P R TDR SQQ Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQ 129 >SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) Length = 556 Score = 54.0 bits (124), Expect = 3e-07 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL-GTP 878 +P QAAQ +G GLFAITPAGERGMCCKA KL G P Sbjct: 257 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVGKP 297 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 53.6 bits (123), Expect = 4e-07 Identities = 28/54 (51%), Positives = 30/54 (55%) Frame = +2 Query: 839 TGRRFTTS*LGKPWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 TGRR P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 >SB_56401| Best HMM Match : Moricin (HMM E-Value=5.8) Length = 106 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_43571| Best HMM Match : Ank (HMM E-Value=3e-34) Length = 584 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) Length = 980 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_39465| Best HMM Match : PDH (HMM E-Value=1.5) Length = 369 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 53.6 bits (123), Expect = 4e-07 Identities = 28/54 (51%), Positives = 30/54 (55%) Frame = +2 Query: 839 TGRRFTTS*LGKPWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 TGRR P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 53.6 bits (123), Expect = 4e-07 Identities = 28/54 (51%), Positives = 30/54 (55%) Frame = +2 Query: 839 TGRRFTTS*LGKPWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 TGRR P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 53.6 bits (123), Expect = 4e-07 Identities = 28/54 (51%), Positives = 30/54 (55%) Frame = +2 Query: 839 TGRRFTTS*LGKPWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 TGRR P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 98 >SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 53.6 bits (123), Expect = 4e-07 Identities = 28/54 (51%), Positives = 30/54 (55%) Frame = +2 Query: 839 TGRRFTTS*LGKPWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 TGRR P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 >SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 110 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 146 >SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) Length = 405 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 95 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 131 >SB_42228| Best HMM Match : Moricin (HMM E-Value=6.6) Length = 126 Score = 53.6 bits (123), Expect = 4e-07 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 994 PXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTPG 875 P QAAQ +G GLFAITPAGERGMCCKA KL G Sbjct: 11 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLEQNG 50 >SB_39908| Best HMM Match : Prismane (HMM E-Value=3) Length = 456 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 39 Score = 38.3 bits (85), Expect = 0.016 Identities = 20/44 (45%), Positives = 21/44 (47%) Frame = -2 Query: 993 HXPXRLRKXXXXXXXXXXXXLXQLAKGECAARRXSWVRQGFPSH 862 H P RLR L QLAKG CAARR SW R+ H Sbjct: 321 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWGRESGTVH 364 >SB_37382| Best HMM Match : Pkinase (HMM E-Value=1e-04) Length = 177 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_37193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) Length = 472 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 39 >SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 182 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 218 >SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) Length = 745 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 997 LPXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 +P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 387 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 423 >SB_41709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 460 Score = 53.2 bits (122), Expect = 5e-07 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -1 Query: 994 PXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 11 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 46 >SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) Length = 407 Score = 53.2 bits (122), Expect = 5e-07 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -1 Query: 994 PXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 11 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 46 >SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 53.2 bits (122), Expect = 5e-07 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -1 Query: 994 PXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 11 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 46 >SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) Length = 108 Score = 53.2 bits (122), Expect = 5e-07 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -1 Query: 994 PXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL 887 P QAAQ +G GLFAITPAGERGMCCKA KL Sbjct: 6 PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL 41 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 52.8 bits (121), Expect = 7e-07 Identities = 28/50 (56%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +1 Query: 823 SRITIHWPAFYNVVTGKTLAYPTXSPCSTF-PFRQLX**RXGPTDRXSQQ 969 SRITIHWP+FYNVVTGKTLA P + PF TDR SQQ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQ 51 Score = 41.1 bits (92), Expect = 0.002 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = +2 Query: 890 LXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXW 994 L LAAH PFASW NSE A LRSL G W Sbjct: 25 LIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 52.8 bits (121), Expect = 7e-07 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = -2 Query: 918 KGECAARRXSWVRQGFPSHDVVKRRPVNCNTTHYRAN 808 +G C +GFPSHD KRRPVNCNTTHYRAN Sbjct: 61 RGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 Score = 50.4 bits (115), Expect = 4e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -1 Query: 982 QAAQTVGXGDRWGLFAITPAGERGMCCKAXKLG 884 + AQ +G GLFAITPAGERGMCCKA KLG Sbjct: 39 RVAQLLGRSIGAGLFAITPAGERGMCCKAIKLG 71 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 9e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 864 HDVVKRRPVNCNTTHYRANW 805 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 9e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 864 HDVVKRRPVNCNTTHYRANW 805 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 52.0 bits (119), Expect = 1e-06 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +1 Query: 823 SRITIHWPAFYNVVTGKTLAYPTXSPCSTF-PFRQLX**RXGPTDRXSQQ 969 SRITIHWP+FYNVVTGKTLA P PF TDR SQQ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQ 51 Score = 32.7 bits (71), Expect = 0.80 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +2 Query: 914 PFASWXNSEXAPPIAXPNSLRSLXGXW 994 PFASW NSE A LRSL G W Sbjct: 33 PFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.2 bits (117), Expect = 2e-06 Identities = 27/50 (54%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +1 Query: 823 SRITIHWPAFYNVVTGKTLAYPTXSPCSTFP-FRQLX**RXGPTDRXSQQ 969 SRITIHWP+FYNVVTGKTLA P P + TDR SQQ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQ 51 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 51.2 bits (117), Expect = 2e-06 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -2 Query: 873 FPSHDVVKRRPVNCNTTHYRAN 808 F SHDVVKRRPVNCNTTHYRAN Sbjct: 19 FRSHDVVKRRPVNCNTTHYRAN 40 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 919 ERGMCCKAXKLGTPGFSQS 863 ERGMCCKA KLG +S Sbjct: 3 ERGMCCKAIKLGNASVFRS 21 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 50.4 bits (115), Expect = 4e-06 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = +3 Query: 852 LQRRDWENPGVPNLXALQHIPLSPAGVIAXRPHRSPFPTV 971 LQRRDWENPGV L L P + + RPHRSPFPTV Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPFASWRNSERPHRSPFPTV 387 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/34 (58%), Positives = 20/34 (58%) Frame = +2 Query: 839 TGRRFTTS*LGKPWRTQLXRLAAHSPFASWXNSE 940 TGR P TQL RLAAH PFASW NSE Sbjct: 344 TGRHLQRRDWENPGVTQLNRLAAHPPFASWRNSE 377 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 50.4 bits (115), Expect = 4e-06 Identities = 27/50 (54%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +1 Query: 823 SRITIHWPAFYNVVTGKTLAYPTXSPCSTF-PFRQLX**RXGPTDRXSQQ 969 SRITIHWP+FYNVVTGKTLA P PF TDR SQ+ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQR 51 Score = 36.7 bits (81), Expect = 0.049 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +2 Query: 890 LXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXW 994 L L H PFASW NSE A LRSL G W Sbjct: 25 LIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2806 Score = 50.0 bits (114), Expect = 5e-06 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = -1 Query: 982 QAAQTVGXGDRWGLFAITPAGERGMCCKAXKLGTPGFSQ 866 +AAQ +G GLFAITPAGERGMCCKA KL + + Sbjct: 2653 KAAQLLGRAIGAGLFAITPAGERGMCCKAIKLDIDSYDR 2691 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 50.0 bits (114), Expect = 5e-06 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQIGXVIFC*NXX*IFVXSSF 1054 P TQL RLAAH PFASW NSE A LRSL G W++ + IF S F Sbjct: 53 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCGIFELSDF 112 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 74 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 37 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHP 49 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 61 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 40 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 41 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 30 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHP 42 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 845 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 886 Score = 37.1 bits (82), Expect = 0.037 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = +3 Query: 786 SRGGPVXXXXXXXXXXXXLAGVLQRRDWENPGVPNLXALQHIP 914 SRG P+ LA VLQRRDWENPGV L L P Sbjct: 817 SRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHP 857 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 126 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHP 138 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 51 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 23 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHP 35 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 31 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHP 43 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 100 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 49 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 144 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHP 156 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 34 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 165 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHP 177 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 69 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 33 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 59 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 Score = 33.9 bits (74), Expect = 0.35 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 849 VLQRRDWENPGVPNLXALQHIP 914 VLQRRDWENPGV L L P Sbjct: 50 VLQRRDWENPGVTQLNRLAAHP 71 >SB_51067| Best HMM Match : UPF0126 (HMM E-Value=1.4) Length = 96 Score = 49.6 bits (113), Expect = 7e-06 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = -1 Query: 994 PXXXQAAQTVGXGDRWGLFAITPAGERGMCCKAXKL-GTP 878 P QAAQ +G GLFAITPAGERGM CKA KL G P Sbjct: 6 PFAIQAAQLLGRAIGAGLFAITPAGERGMSCKAIKLAGKP 45 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 72 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 225 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 266 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHP 237 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 45 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHP 57 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 60 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHP 72 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 52 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 87 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 128 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHP 99 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 34 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 69 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 112 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHP 124 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 40 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHP 52 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 158 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHP 170 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 71 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 100 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 112 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHP 124 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 1202 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1243 Score = 35.9 bits (79), Expect = 0.086 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 993 HXPXRLRKXXXXXXXXXXXXLXQLAKGECAARRXSW 886 H P RLR L QLAKG CAARR SW Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 439 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHP 1214 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 44 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 137 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 178 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHP 149 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 89 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 130 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHP 101 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 43 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 46 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 48 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 108 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 149 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHP 120 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 73 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHP 85 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 96 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 52 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 96 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 96 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 33 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHP 45 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 77 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 36 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 120 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHP 132 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 36 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHP 48 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 55 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 88 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 129 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHP 100 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 79 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 103 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 144 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHP 115 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 53 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 1075 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1116 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHP 1087 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 29 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 43 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 146 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 187 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHP 158 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 194 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 235 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHP 206 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 182 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 223 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHP 194 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 71 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 31 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHP 43 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 158 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHP 170 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 70 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 128 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 169 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHP 140 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 35 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 76 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHP 47 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 664 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 705 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHP 676 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 51 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 173 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 214 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHP 185 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 59 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHP 71 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 44 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 34 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 70 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 82 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 29 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 72 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 Score = 34.3 bits (75), Expect = 0.26 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +2 Query: 896 RLAAHSPFASWXNSEXAPPIAXPNSLRSLXG 988 +++AH PFASW NSE A LRSL G Sbjct: 14 QVSAHPPFASWRNSEEARTDRPSQQLRSLNG 44 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 83 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHP 95 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 91 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 197 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 238 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHP 209 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 456 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 497 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHP 468 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 278 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 319 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHP 290 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 46 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 73 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHP 85 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 82 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 116 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 75 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 29 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 86 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 127 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHP 98 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 95 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 188 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 229 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHP 200 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 43 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHP 55 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 95 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 61 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 85 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 154 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 195 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHP 166 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 80 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 121 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHP 92 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 69 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 81 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 50 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 56 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 74 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 93 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHP 105 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 203 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 244 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHP 215 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 99 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 140 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHP 111 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 116 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHP 128 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 50 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 62 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 103 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 61 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 53 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 34 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHP 46 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 138 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHP 150 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 55 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 81 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 67 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 30 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHP 42 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 66 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 100 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHP 112 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 67 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 70 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 32 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHP 44 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 106 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 147 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHP 118 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 77 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 179 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 220 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHP 191 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 74 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 54 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 95 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHP 66 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 29 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHP 41 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 45 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHP 57 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 91 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHP 103 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 69 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 46 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 117 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 158 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHP 129 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 58 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 99 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHP 70 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 48 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 131 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 172 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHP 143 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 164 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 205 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHP 176 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 114 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 155 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHP 126 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 46 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 67 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 49 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 68 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 168 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 209 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 156 LAVVLQRRDWENPGVTQLNRLAAHP 180 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 39 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 80 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 27 LAVVLQRRDWENPGVTQLNRLAAHP 51 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 81 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 138 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHP 150 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 70 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 101 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 142 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 89 LAVVLQRRDWENPGVTQLNRLAAHP 113 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 30 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHP 42 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 38 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHP 50 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 83 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHP 95 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 97 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHP 109 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 56 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 105 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 157 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 198 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 145 LAVVLQRRDWENPGVTQLNRLAAHP 169 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 803 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 844 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 791 LAVVLQRRDWENPGVTQLNRLAAHP 815 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 84 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHP 96 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 105 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 67 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 119 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 160 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHP 131 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 7e-06 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 875 PWRTQLXRLAAHSPFASWXNSEXAPPIAXPNSLRSLXGXWQI 1000 P TQL RLAAH PFASW NSE A LRSL G W++ Sbjct: 28 PGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 35.9 bits (79), Expect = 0.086 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 840 LAGVLQRRDWENPGVPNLXALQHIP 914 LA VLQRRDWENPGV L L P Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHP 40 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,203,865 Number of Sequences: 59808 Number of extensions: 651106 Number of successful extensions: 8540 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8347 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4965079671 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -