BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_E08_e349_10.seq (1528 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g23190.1 68416.m02924 lesion inducing protein-related similar... 33 0.66 >At3g23190.1 68416.m02924 lesion inducing protein-related similar to ORF, able to induce HR-like lesions [Nicotiana tabacum] Length = 216 Score = 32.7 bits (71), Expect = 0.66 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = +1 Query: 82 KLLSSALIVFCTYNLFTNVTMSEAFFDE--YDYYNFDHDKHIFTGHGGKQRTKREATEHT 255 K + L +F TY + + +A YD+YN D+D+ FT K +E E T Sbjct: 73 KFVGGILFIFNTYVGAALLLVYQAILSPILYDFYNRDYDRDHFTVFYTK---FKEFVEET 129 Query: 256 NHFDPSGHSRKIVTKLVNTENNKK 327 D G + + T +VN E+ +K Sbjct: 130 TSAD-GGVAMSLYTSVVNEESRQK 152 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,623,044 Number of Sequences: 28952 Number of extensions: 431405 Number of successful extensions: 835 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 835 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4086763008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -