BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_E07_e341_09.seq (1517 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 28 3.9 SPAC2G11.07c |ptc3||protein phosphatase 2C Ptc3|Schizosaccharomy... 27 9.0 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 27.9 bits (59), Expect = 3.9 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 295 ATYWCPTCIRLYRIRGL*AICDGRTSRSTLRL 390 A WC R+ IRG+ AI D RTS+ T+ L Sbjct: 381 AMAWCENFRRVL-IRGIFAIMDARTSKCTVSL 411 >SPAC2G11.07c |ptc3||protein phosphatase 2C Ptc3|Schizosaccharomyces pombe|chr 1|||Manual Length = 414 Score = 26.6 bits (56), Expect = 9.0 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 148 FINRLKT*IVNGNTLLSVPALFNVPPGGCEAMLLLAI 258 F+N LK+ +N + + F+ P GC A ++L + Sbjct: 92 FVNALKSSFLNADKAILDDDQFHTDPSGCTATVVLRV 128 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,842,253 Number of Sequences: 5004 Number of extensions: 92495 Number of successful extensions: 146 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 850352646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -