BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_E06_e333_10.seq (1524 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54877| Best HMM Match : NAD_binding_4 (HMM E-Value=0) 64 2e-10 SB_46750| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 >SB_54877| Best HMM Match : NAD_binding_4 (HMM E-Value=0) Length = 373 Score = 64.5 bits (150), Expect = 2e-10 Identities = 30/66 (45%), Positives = 46/66 (69%) Frame = +2 Query: 77 RVISLVGTLSDEALDEIEPKLLKDHPNTYTFTKHLAEHEVVKCADLFPCTIVRPTMIVAS 256 ++IS + +SD+ + I P ++ PNTYTFTK LAEH +++ A P +I RP++I AS Sbjct: 159 KLISSLEWMSDDMVKAITPYVIDQRPNTYTFTKSLAEHVLLQEASGLPVSIFRPSIIGAS 218 Query: 257 WKEPVP 274 +KEP+P Sbjct: 219 FKEPLP 224 Score = 56.8 bits (131), Expect = 4e-08 Identities = 39/174 (22%), Positives = 73/174 (41%), Gaps = 2/174 (1%) Frame = +2 Query: 368 ADYIPVDVVVNEILVAGWHTA--TTKSGLTVYHCSSSTQKPFCWSMLENSVNGNLHKYPL 541 A +PV + I+ A + G+ VY+C + P W + ++ YP+ Sbjct: 202 ASGLPVSIFRPSIIGASFKEPLPVPSDGIPVYNCGTGVLNPITWGEISEIMHKTFSIYPM 261 Query: 542 KSAVWYPHLKFVPSLWLFRLSAIFIHFIPAILLDMVLRVTGGRPILFRLHKNVWNSLGRL 721 + P+ F S ++ H IPA++ DM+ G +P + RL++ + + + Sbjct: 262 EDVFRRPNFNFESSKLMYYYWTYISHRIPALIADMLSIFIGQKPKMNRLYRKLQKATDVM 321 Query: 722 EKFIFTEWRFHNPHTIQLAKELNKTDSELFYIDITTIYWEDYFKNLLLGVRRYL 883 + F EW KE F D+ I W YF++ +G++++L Sbjct: 322 KVFTSREW-----------KE--------FGFDVRVIDWNKYFEDFTIGMKQFL 356 >SB_46750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 29.5 bits (63), Expect = 7.4 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 Query: 71 GTRVISLVGTLSDEALDEIEPKLLKDHPNTYTFTKHLAE 187 G R ++ ALD I PKL +DH N K L E Sbjct: 153 GMRQAGVLAAAGIYALDNIAPKLSQDHENARALAKGLQE 191 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,718,923 Number of Sequences: 59808 Number of extensions: 770427 Number of successful extensions: 1626 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1625 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4953341894 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -