BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_E05_e325_09.seq (1531 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 23 7.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 7.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 7.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 7.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 7.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 7.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 7.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 7.9 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 363 DRTRVD*RGIRPHYSLRHDR*TKLEIRLDFN 455 D+ + R +R H L+HD +LE + F+ Sbjct: 13 DQDQCSHRIVREHLGLKHDNYYELETHIFFD 43 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 363 DRTRVD*RGIRPHYSLRHDR*TKLEIRLDFN 455 D+ + R +R H L+HD +LE + F+ Sbjct: 327 DQDQCSHRIVREHLGLKHDNYYELETHIFFD 357 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 7.9 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +1 Query: 544 IGLVLHYNRSFCICPQILY*LVLSRLAIITVI 639 I LH +CI P I+Y L + + ++ ++ Sbjct: 1017 IAACLHPQEFWCIVPGIIYLLSIPSMYLLLIL 1048 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 7.9 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +1 Query: 544 IGLVLHYNRSFCICPQILY*LVLSRLAIITVI 639 I LH +CI P I+Y L + + ++ ++ Sbjct: 1017 IAACLHPQEFWCIVPGIIYLLSIPSMYLLLIL 1048 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 363 DRTRVD*RGIRPHYSLRHDR*TKLEIRLDFN 455 D+ + R +R H L+HD +LE + F+ Sbjct: 560 DQDQCSHRIVREHLGLKHDNYYELETHIFFD 590 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 363 DRTRVD*RGIRPHYSLRHDR*TKLEIRLDFN 455 D+ + R +R H L+HD +LE + F+ Sbjct: 560 DQDQCSHRIVREHLGLKHDNYYELETHIFFD 590 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 7.9 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +1 Query: 544 IGLVLHYNRSFCICPQILY*LVLSRLAIITVI 639 I LH +CI P I+Y L + + ++ ++ Sbjct: 1017 IAACLHPQEFWCIVPGIIYLLSIPSMYLLLIL 1048 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 7.9 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +1 Query: 544 IGLVLHYNRSFCICPQILY*LVLSRLAIITVI 639 I LH +CI P I+Y L + + ++ ++ Sbjct: 1017 IAACLHPQEFWCIVPGIIYLLSIPSMYLLLIL 1048 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 261,818 Number of Sequences: 336 Number of extensions: 4591 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45988825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -