BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_E05_e325_09.seq (1531 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55374-8|AAB36868.3| 1538|Caenorhabditis elegans Uncoordinated p... 30 3.8 U55374-6|AAM69092.1| 1926|Caenorhabditis elegans Uncoordinated p... 30 3.8 U55374-5|AAP82640.2| 2027|Caenorhabditis elegans Uncoordinated p... 30 3.8 U25119-1|AAA85728.1| 1053|Caenorhabditis elegans Unc-2 protein. 30 3.8 AY264781-1|AAP13107.1| 2027|Caenorhabditis elegans high voltage ... 30 3.8 >U55374-8|AAB36868.3| 1538|Caenorhabditis elegans Uncoordinated protein 2, isoform a protein. Length = 1538 Score = 30.3 bits (65), Expect = 3.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 192 RYWFSSDAAGTHLLVFGDRFSNLRVVATQAGIIRKCP 302 R W D A T + + + + LR++A G +KCP Sbjct: 1326 RVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCP 1362 >U55374-6|AAM69092.1| 1926|Caenorhabditis elegans Uncoordinated protein 2, isoform c protein. Length = 1926 Score = 30.3 bits (65), Expect = 3.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 192 RYWFSSDAAGTHLLVFGDRFSNLRVVATQAGIIRKCP 302 R W D A T + + + + LR++A G +KCP Sbjct: 1326 RVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCP 1362 >U55374-5|AAP82640.2| 2027|Caenorhabditis elegans Uncoordinated protein 2, isoform b protein. Length = 2027 Score = 30.3 bits (65), Expect = 3.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 192 RYWFSSDAAGTHLLVFGDRFSNLRVVATQAGIIRKCP 302 R W D A T + + + + LR++A G +KCP Sbjct: 1445 RVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCP 1481 >U25119-1|AAA85728.1| 1053|Caenorhabditis elegans Unc-2 protein. Length = 1053 Score = 30.3 bits (65), Expect = 3.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 192 RYWFSSDAAGTHLLVFGDRFSNLRVVATQAGIIRKCP 302 R W D A T + + + + LR++A G +KCP Sbjct: 932 RVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCP 968 >AY264781-1|AAP13107.1| 2027|Caenorhabditis elegans high voltage activated calciumchannel alpha-1 subunit protein. Length = 2027 Score = 30.3 bits (65), Expect = 3.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 192 RYWFSSDAAGTHLLVFGDRFSNLRVVATQAGIIRKCP 302 R W D A T + + + + LR++A G +KCP Sbjct: 1445 RVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCP 1481 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,654,779 Number of Sequences: 27780 Number of extensions: 431807 Number of successful extensions: 595 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4400652752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -