BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_E03_e309_09.seq (1619 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21317-4|AAA62523.1| 719|Caenorhabditis elegans Hypothetical pr... 31 2.3 Z81545-8|CAB04444.1| 327|Caenorhabditis elegans Hypothetical pr... 29 9.3 >U21317-4|AAA62523.1| 719|Caenorhabditis elegans Hypothetical protein B0495.2 protein. Length = 719 Score = 31.1 bits (67), Expect = 2.3 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +2 Query: 101 TFTQXYSPTDKRRELLPRVQRARSGRRQHVAFPIAYCRPINNTLVILNSVNIINV 265 TF Y DKR + + ++R + + + FPI R IN L N NI+NV Sbjct: 366 TFGVVYRGKDKRTDEIVALKRLKMEKEKE-GFPITALREINMLLKAGNHPNIVNV 419 >Z81545-8|CAB04444.1| 327|Caenorhabditis elegans Hypothetical protein F49H6.11 protein. Length = 327 Score = 29.1 bits (62), Expect = 9.3 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -1 Query: 266 IHL*YLHCLISQVYCLLVDSTLLGMLRVDVGRSERAVRAVTVHVVY 129 I L YL C ++++Y L L++ GR + V + HV + Sbjct: 279 IQLSYLRCNLNELYNLFTSFNCCKFLKIVFGRVDATVHPILPHVAF 324 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,960,935 Number of Sequences: 27780 Number of extensions: 449694 Number of successful extensions: 879 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4712019692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -