BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_E03_e309_09.seq (1619 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57380.1 68418.m07169 fibronectin type III domain-containing ... 30 4.9 At1g19230.1 68414.m02393 respiratory burst oxidase protein E (Rb... 29 6.5 >At5g57380.1 68418.m07169 fibronectin type III domain-containing protein / PHD finger protein-related contains Pfam profiles PF00041: Fibronectin type III domain, PF00628: PHD-finger Length = 600 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 656 DRDRVECCSSLEQESTIKERGLQRQRAKNRLSGR 757 D+D E CS+ E ES ++E L +++A N++ GR Sbjct: 434 DKDNTEHCSAGEVESELEEERLVKRKA-NKIDGR 466 >At1g19230.1 68414.m02393 respiratory burst oxidase protein E (RbohE) / NADPH oxidase nearly identical to respiratory burst oxidase protein E GI:3242787 [gi:3242787] from [Arabidopsis thaliana] Length = 926 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +1 Query: 712 TWTPTSK--GEKPSIRAMAHYVNHHPNQVFWGRGARKALN 825 T TPTS G+K +++A ++V P V W RG + ++ Sbjct: 777 TATPTSTHGGKKKAVKAHFYWVTREPGSVEWFRGVMEEIS 816 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,774,650 Number of Sequences: 28952 Number of extensions: 412181 Number of successful extensions: 803 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 803 length of database: 12,070,560 effective HSP length: 85 effective length of database: 9,609,640 effective search space used: 4362776560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -