BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_E02_e301_10.seq (1558 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-... 23 7.1 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 23 9.4 >M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H17. ). Length = 79 Score = 23.0 bits (47), Expect = 7.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 263 PEIKPKTPFGQMPLLEIDGK 322 P KP+TPF LL ++ K Sbjct: 8 PNRKPRTPFTTQQLLSLEKK 27 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 488 AKKLAEFRETKYQFLIEKLNEILQKNGGHI 577 A K +F E L E+ +++ +NG HI Sbjct: 311 ANKNQKFYERGIMMLPERWQKVIDQNGQHI 340 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 275,451 Number of Sequences: 438 Number of extensions: 5172 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 54668625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -