BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_D07_e340_07.seq (1512 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 25 4.3 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 24 10.0 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 25.4 bits (53), Expect = 4.3 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 400 IGLYIV*FFCFVLFYVKYFGYCVQANCIGKNITERLL 510 +GL+++ F+C L ++ + +G N ERLL Sbjct: 338 VGLFVIVFYCMSLLFIICNEAHHASKRVGLNFQERLL 374 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 24.2 bits (50), Expect = 10.0 Identities = 13/52 (25%), Positives = 25/52 (48%) Frame = +3 Query: 354 LVSVPSCYI*FNNLCYWTIYCVIFLFCFVLRKIFWLLCPSELYWKEYHGTFI 509 +VSV +C + +L Y+T + ++ F WL+ EL + + F+ Sbjct: 850 IVSVVACLVAALSLVYYTYKLELKVWLFKHGLCLWLVAEEELDRDKLYDAFV 901 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,054,562 Number of Sequences: 2352 Number of extensions: 19916 Number of successful extensions: 38 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 177188220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -