BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_D05_e324_07.seq (1507 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g34190.1 68414.m04241 no apical meristem (NAM) family protein... 31 2.6 >At1g34190.1 68414.m04241 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) protein; similar to NAM protein GI:6066595 [Petunia hybrida]; nam-like protein 9 (GI:21105746) [Petunia x hybrida]; NAC1 GI:7716952 [Medicago truncatula] Length = 557 Score = 30.7 bits (66), Expect = 2.6 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -3 Query: 305 NISKPLSRSRNSPDNSMKILYSDFQDRTKKNILENPIMPLT 183 N+S + + D ++LY FQD+T +N L N + P T Sbjct: 361 NLSSLSDSANYTSDQKQQLLYQQFQDQTPENQLNNIMDPST 401 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,536,548 Number of Sequences: 28952 Number of extensions: 386736 Number of successful extensions: 870 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4019292864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -