BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_D04_e316_08.seq (1542 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 25 2.3 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 25 2.3 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 25 2.3 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 7.0 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 7.0 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 112 PDESYSAYTIAFGIRNCTHIEKVLEEAYRVLVPGGR 219 PDESY++ + H +++L ++ L+ GR Sbjct: 21 PDESYTSKFDNINVDEILHSDRLLNNYFKCLMDEGR 56 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 112 PDESYSAYTIAFGIRNCTHIEKVLEEAYRVLVPGGR 219 PDESY++ + H +++L ++ L+ GR Sbjct: 21 PDESYTSKFDNINVDEILHSDRLLNNYFKCLMDEGR 56 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 112 PDESYSAYTIAFGIRNCTHIEKVLEEAYRVLVPGGR 219 PDESY++ + H +++L ++ L+ GR Sbjct: 21 PDESYTSKFDNINVDEILHSDRLLNNYFKCLMDEGR 56 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 7.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 243 VTELQTHEATAGN*HAIRLFKDLFN 169 ++ L H A AGN A RL+ DL + Sbjct: 14 LSALVVHGAVAGNPDAKRLYDDLLS 38 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 7.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 243 VTELQTHEATAGN*HAIRLFKDLFN 169 ++ L H A AGN A RL+ DL + Sbjct: 14 LSALVVHGAVAGNPDAKRLYDDLLS 38 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 266,997 Number of Sequences: 438 Number of extensions: 5012 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 54070500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -