BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_D03_e308_07.seq (1610 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 26 0.90 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 25.8 bits (54), Expect = 0.90 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -1 Query: 407 TPSGHNIRIVHRHAYYFRNALTFH-LISVLHVSRQMSLRTPRSKRSRYSKQDNF 249 T +GH I+ + + Y + FH L + ++ PR + KQDNF Sbjct: 140 TLNGHEIKFIRKEEYISFESKVFHKLKKMKYLVEVQDEVKPRGVLNIIPKQDNF 193 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 274,329 Number of Sequences: 336 Number of extensions: 5615 Number of successful extensions: 16 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 48754300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -