Samia BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030723E4_D02_e300_08.seq
         (1493 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A3RV15 Cluster: Transcriptional regulatory protein; n=2...    35   6.3  

>UniRef50_A3RV15 Cluster: Transcriptional regulatory protein; n=2;
           Ralstonia solanacearum|Rep: Transcriptional regulatory
           protein - Ralstonia solanacearum UW551
          Length = 296

 Score = 34.7 bits (76), Expect = 6.3
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = +3

Query: 540 GTFLLSIIPEFGICARYGDRLAPCHIRDGTKLCEMWV 650
           GT LL+++P   +    G R+ P  +R+   L EMWV
Sbjct: 233 GTDLLAVVPHPALIGEAGKRVTPLRLRESLPLYEMWV 269


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,079,246,389
Number of Sequences: 1657284
Number of extensions: 20247451
Number of successful extensions: 44392
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 41476
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44386
length of database: 575,637,011
effective HSP length: 104
effective length of database: 403,279,475
effective search space used: 158488833675
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)