BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_D01_e292_07.seq (1545 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 26 0.86 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 24 3.5 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 25.8 bits (54), Expect = 0.86 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = -2 Query: 263 YSCDPTIRR-FHSVLPVQRVYQACHNNGLDHTARGQQGCILSGNHRKPFFLTNLSNTIEN 87 Y C+ TI FHSVLP++R + + D+ + C + G H FFL + Sbjct: 155 YVCNTTIFLIFHSVLPIKRFFTSL-GIAFDNIMKNLI-CEIDGRHE--FFLAEFKSA--- 207 Query: 86 RRPSCRIXC 60 + P ++ C Sbjct: 208 KTPPNKLNC 216 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.8 bits (49), Expect = 3.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 701 PLSPAGVIAKRPAPIALPNSCA 766 P P GV KR P AL +CA Sbjct: 52 PCPPQGVDLKRVLPEALQTNCA 73 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 255,151 Number of Sequences: 336 Number of extensions: 5573 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 46500950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -