BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_D01_e292_07.seq (1545 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4F6.06 |kin1||microtubule affinity-regulating kinase Kin1 |S... 31 0.32 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 27 9.2 SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosacc... 27 9.2 >SPBC4F6.06 |kin1||microtubule affinity-regulating kinase Kin1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 31.5 bits (68), Expect = 0.32 Identities = 14/64 (21%), Positives = 34/64 (53%) Frame = +2 Query: 359 FQLLVGSMTFFYMINYGKMKHHRNYKYH*RSNSTINLFVHENIIIQDSTGLSHVYISYCN 538 F+ + G Y+I++GK+K + K+ + S ++ ++H+N ++ + ++ IS Sbjct: 220 FEFVDGGQMLDYIISHGKLKEKQARKFVRQIGSALS-YLHQNSVVHRDLKIENILISKTG 278 Query: 539 KISV 550 I + Sbjct: 279 DIKI 282 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 26.6 bits (56), Expect = 9.2 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +2 Query: 593 PIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIALPN 757 P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L + Sbjct: 172 PRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRLYS 231 Query: 758 SCA 766 S A Sbjct: 232 SDA 234 >SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 732 Score = 26.6 bits (56), Expect = 9.2 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 700 PPFASWRNSEEARTDRPSQQLRSLN 774 PP AS RN E + PS+Q S+N Sbjct: 353 PPGASGRNRRERTSSTPSEQSTSVN 377 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,343,096 Number of Sequences: 5004 Number of extensions: 86757 Number of successful extensions: 160 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 868192212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -