BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_D01_e292_07.seq (1545 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR542155-1|CAG46952.1| 94|Homo sapiens ATP5J2 protein. 59 4e-08 CR456891-1|CAG33172.1| 94|Homo sapiens ATP5J2 protein. 59 4e-08 AY046911-1|AAL06647.1| 88|Homo sapiens F1Fo-ATP synthase compl... 59 4e-08 AF088918-1|AAC34895.1| 94|Homo sapiens F1F0-type ATPase subuni... 59 4e-08 AK223348-1|BAD97068.1| 94|Homo sapiens ATP synthase, H+ transp... 59 5e-08 BC003678-1|AAH03678.1| 94|Homo sapiens ATP synthase, H+ transp... 58 9e-08 >CR542155-1|CAG46952.1| 94|Homo sapiens ATP5J2 protein. Length = 94 Score = 59.3 bits (137), Expect = 4e-08 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = +2 Query: 218 QVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYM 397 +VKL E+ W+ R +PS + GA R ++R+ +KY+ KK ++ +L + F Y Sbjct: 20 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 398 INYGKMKHHRNYKYH 442 +Y +KH R KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >CR456891-1|CAG33172.1| 94|Homo sapiens ATP5J2 protein. Length = 94 Score = 59.3 bits (137), Expect = 4e-08 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = +2 Query: 218 QVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYM 397 +VKL E+ W+ R +PS + GA R ++R+ +KY+ KK ++ +L + F Y Sbjct: 20 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 398 INYGKMKHHRNYKYH 442 +Y +KH R KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >AY046911-1|AAL06647.1| 88|Homo sapiens F1Fo-ATP synthase complex Fo membrane domain f subunit protein. Length = 88 Score = 59.3 bits (137), Expect = 4e-08 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = +2 Query: 218 QVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYM 397 +VKL E+ W+ R +PS + GA R ++R+ +KY+ KK ++ +L + F Y Sbjct: 14 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 73 Query: 398 INYGKMKHHRNYKYH 442 +Y +KH R KYH Sbjct: 74 FSYKHLKHERLRKYH 88 >AF088918-1|AAC34895.1| 94|Homo sapiens F1F0-type ATPase subunit f protein. Length = 94 Score = 59.3 bits (137), Expect = 4e-08 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = +2 Query: 218 QVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYM 397 +VKL E+ W+ R +PS + GA R ++R+ +KY+ KK ++ +L + F Y Sbjct: 20 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 398 INYGKMKHHRNYKYH 442 +Y +KH R KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >AK223348-1|BAD97068.1| 94|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f isoform 2a v protein. Length = 94 Score = 58.8 bits (136), Expect = 5e-08 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = +2 Query: 218 QVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYM 397 +VKL E+ W+ R +PS + GA R ++R+ +KY+ KK ++ +L + F Y Sbjct: 20 EVKLGELPSWVLMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 398 INYGKMKHHRNYKYH 442 +Y +KH R KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >BC003678-1|AAH03678.1| 94|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2 protein. Length = 94 Score = 58.0 bits (134), Expect = 9e-08 Identities = 26/75 (34%), Positives = 42/75 (56%) Frame = +2 Query: 218 QVKLNEIGGWLGRRSKTPSAVMGACSRAWWRWQHKYVQPKKVGMAPFFQLLVGSMTFFYM 397 +VKL E+ W+ R +PS + GA R ++R+ +KY+ KK ++ +L + F Y Sbjct: 20 EVKLLELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 398 INYGKMKHHRNYKYH 442 +Y +KH R KYH Sbjct: 80 FSYKHLKHERLRKYH 94 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,041,266 Number of Sequences: 237096 Number of extensions: 3629739 Number of successful extensions: 10683 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10683 length of database: 76,859,062 effective HSP length: 93 effective length of database: 54,809,134 effective search space used: 23074645414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -