BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_D01_e292_07.seq (1545 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66515-4|CAA91350.1| 153|Caenorhabditis elegans Hypothetical pr... 67 4e-11 Z99280-2|CAE18017.1| 129|Caenorhabditis elegans Hypothetical pr... 29 8.8 >Z66515-4|CAA91350.1| 153|Caenorhabditis elegans Hypothetical protein R53.4 protein. Length = 153 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/69 (46%), Positives = 38/69 (55%) Frame = +2 Query: 119 KMAFGDYPKEYNPAVHGPYDPARYYGKPDTPFGQVKLNEIGGWLGRRSKTPSAVMGACSR 298 K G + K +N VHGPY RYYGK DT F VKL ++ W+ RR KTPSA R Sbjct: 43 KTEVGLFDKRWNKNVHGPYCHWRYYGKLDTKFMDVKLGDLPAWMARREKTPSAFYNEFMR 102 Query: 299 AWWRWQHKY 325 WR + Y Sbjct: 103 NIWRVHNLY 111 >Z99280-2|CAE18017.1| 129|Caenorhabditis elegans Hypothetical protein Y57G11B.6 protein. Length = 129 Score = 29.1 bits (62), Expect = 8.8 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 352 SHAYFFRLNIFVLPPPPGSAASAHNS*RSLTPATQPSA 239 +H Y + F P P S A HNS S P +PSA Sbjct: 71 NHGYSAHVTGFEAHPSPPSTAQHHNSTMSSLPPRRPSA 108 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,757,830 Number of Sequences: 27780 Number of extensions: 514014 Number of successful extensions: 1159 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1158 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4452547242 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -