BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_D01_e292_07.seq (1545 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 5.3 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 5.3 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 5.3 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.4 bits (48), Expect = 5.3 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +2 Query: 185 RYYGKPDTPFGQV--KLNEIGGWLGRRSKTPSAVMGA 289 R+Y P TPFG V K+N L +TP ++ + Sbjct: 290 RFYYNPFTPFGPVTEKVNNDSNSLPFIDRTPIEIINS 326 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.4 bits (48), Expect = 5.3 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 266 SYSCDPTIRRFHSVLPVQRVYQAC 195 SY CD + F L + +Y AC Sbjct: 129 SYDCDVDVSTFFDQLGQEVIYTAC 152 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.4 bits (48), Expect = 5.3 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +2 Query: 185 RYYGKPDTPFGQV--KLNEIGGWLGRRSKTPSAVMGA 289 R+Y P TPFG V K+N L +TP ++ + Sbjct: 290 RFYYNPFTPFGPVTEKVNNDSNSLPFIDRTPIEIINS 326 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 303,984 Number of Sequences: 438 Number of extensions: 6817 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 54190125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -