BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_C12_e379_06.seq (1539 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27650.1 68418.m03313 PWWP domain-containing protein hypothet... 30 4.7 At2g16090.1 68415.m01845 zinc finger protein-related contains si... 29 8.2 >At5g27650.1 68418.m03313 PWWP domain-containing protein hypothetical protein F22F7.12 - Arabidopsis thaliana, EMBL:AC009606 Length = 1072 Score = 29.9 bits (64), Expect = 4.7 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -3 Query: 544 WVPHSCKLTSKEVPGETINLQTCLRCPVNYPWLNDPTGDGH 422 W+ + L +P +NL++CL+ PV+ P + G+G+ Sbjct: 890 WLDQAPPLHQPTLPPPNVNLKSCLKKPVDDPSSSSNNGNGN 930 >At2g16090.1 68415.m01845 zinc finger protein-related contains similarity to zinc finger proteins and Pfam domain, PF01485: IBR domain Length = 593 Score = 29.1 bits (62), Expect = 8.2 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Frame = -3 Query: 592 FEPWREKCAVEGIPACWVP-HS--CKLTSKEV-PGETINLQTCLRCPVNYPWL-NDPTGD 428 +E WR+KC E W+ H+ C K V NL TCL C ++ WL + TG Sbjct: 260 WELWRKKCFDESETVNWITVHTKPCPKCHKPVEKNGGCNLVTCL-CRQSFCWLCGEATGR 318 Query: 427 GH 422 H Sbjct: 319 DH 320 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,470,101 Number of Sequences: 28952 Number of extensions: 484136 Number of successful extensions: 953 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 951 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4125317376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -