BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_C06_e331_06.seq (1528 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1007 + 33452774-33452993,33453028-33453122,33453208-334533... 29 7.4 >02_05_1007 + 33452774-33452993,33453028-33453122,33453208-33453329, 33453392-33453694,33454657-33454918,33455039-33455140, 33455931-33457151,33457250-33457342 Length = 805 Score = 29.5 bits (63), Expect = 7.4 Identities = 16/62 (25%), Positives = 31/62 (50%) Frame = -3 Query: 539 GLLTCCGVRGEFGGSGWKPMNINVRSTVARSGLDLSTHIMQLLQARRSSAKSSNRMKLSL 360 G ++C G RGEFG K + S+++++ D ST + + +S + + R ++ Sbjct: 143 GFVSCRGNRGEFGLWHLKRFKAEISSSISKTAPDFSTVYVVSKGGKVTSVRQAVRQAPAV 202 Query: 359 LP 354 P Sbjct: 203 SP 204 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,408,664 Number of Sequences: 37544 Number of extensions: 573248 Number of successful extensions: 1313 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1268 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1313 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4907691684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -