SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030723E4_C06_e331_06.seq
         (1528 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g39660.1 68417.m05608 alanine--glyoxylate aminotransferase, p...    30   4.6  

>At4g39660.1 68417.m05608 alanine--glyoxylate aminotransferase,
           putative / beta-alanine-pyruvate aminotransferase,
           putative / AGT, putative similar to SP|Q64565
           Alanine--glyoxylate aminotransferase 2, mitochondrial
           precursor (EC 2.6.1.44) (AGT 2) (Beta-alanine-pyruvate
           aminotransferase) {Rattus norvegicus}; contains Pfam
           profile PF00202: aminotransferase, class III
          Length = 476

 Score = 29.9 bits (64), Expect = 4.6
 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 3/68 (4%)
 Frame = +1

Query: 211 IRKILERKDKQPVKIEFKIF---LTENTVTRWEAVVHGNTMYLRMPGVLQSGSKESFILL 381
           I  + +RKDK P K E  +    L E  +   +  +HGN   ++ P        +  +  
Sbjct: 409 IELVSDRKDKTPAKAETSVLFEQLRELGILVGKGGLHGNVFRIKPPMCFTKDDADFLVDA 468

Query: 382 LDFAEERL 405
           LD++  RL
Sbjct: 469 LDYSISRL 476


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,438,790
Number of Sequences: 28952
Number of extensions: 451720
Number of successful extensions: 1083
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1036
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1079
length of database: 12,070,560
effective HSP length: 84
effective length of database: 9,638,592
effective search space used: 4086763008
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -