BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_C06_e331_06.seq (1528 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39660.1 68417.m05608 alanine--glyoxylate aminotransferase, p... 30 4.6 >At4g39660.1 68417.m05608 alanine--glyoxylate aminotransferase, putative / beta-alanine-pyruvate aminotransferase, putative / AGT, putative similar to SP|Q64565 Alanine--glyoxylate aminotransferase 2, mitochondrial precursor (EC 2.6.1.44) (AGT 2) (Beta-alanine-pyruvate aminotransferase) {Rattus norvegicus}; contains Pfam profile PF00202: aminotransferase, class III Length = 476 Score = 29.9 bits (64), Expect = 4.6 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 3/68 (4%) Frame = +1 Query: 211 IRKILERKDKQPVKIEFKIF---LTENTVTRWEAVVHGNTMYLRMPGVLQSGSKESFILL 381 I + +RKDK P K E + L E + + +HGN ++ P + + Sbjct: 409 IELVSDRKDKTPAKAETSVLFEQLRELGILVGKGGLHGNVFRIKPPMCFTKDDADFLVDA 468 Query: 382 LDFAEERL 405 LD++ RL Sbjct: 469 LDYSISRL 476 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,438,790 Number of Sequences: 28952 Number of extensions: 451720 Number of successful extensions: 1083 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1079 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4086763008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -