BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_C04_e315_06.seq (1570 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical pro... 62 8e-12 >AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical protein protein. Length = 95 Score = 62.5 bits (145), Expect = 8e-12 Identities = 32/77 (41%), Positives = 44/77 (57%) Frame = +1 Query: 271 GKNKIHKRSKIKPFVKGVNYNHLMPTRYSVDXSFEKFSAKDLKDPAKRKKLRFNTRVRFE 450 G+ + +R + +P V G + H+ P S K K P KRK++RF TRV+ + Sbjct: 19 GRGQNTQRVQNQPLVIGCDEKHVSPHVIGGITSGGPIPTKSSKYPIKRKRVRFQTRVKVQ 78 Query: 451 ERYKSGKNKWFFQKLRF 501 E KSG+NKWFFQK RF Sbjct: 79 EGSKSGRNKWFFQKGRF 95 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,195 Number of Sequences: 336 Number of extensions: 4814 Number of successful extensions: 5 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 47320350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -