BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_C04_e315_06.seq (1570 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45618| Best HMM Match : Ribosomal_L27e (HMM E-Value=0) 169 4e-42 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 122 8e-28 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 107 2e-23 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 3e-23 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 105 1e-22 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 1e-22 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 104 2e-22 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 104 2e-22 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 104 2e-22 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 103 3e-22 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 103 3e-22 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 103 3e-22 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 103 3e-22 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 103 3e-22 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 103 3e-22 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 103 3e-22 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 103 3e-22 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 103 3e-22 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 103 3e-22 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 103 3e-22 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 103 4e-22 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 5e-22 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 102 7e-22 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 7e-22 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 9e-22 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 9e-22 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 102 9e-22 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 102 9e-22 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 101 1e-21 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 101 1e-21 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 101 2e-21 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 101 2e-21 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 101 2e-21 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 101 2e-21 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 101 2e-21 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 101 2e-21 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 101 2e-21 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 101 2e-21 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 101 2e-21 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 101 2e-21 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 101 2e-21 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 101 2e-21 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 101 2e-21 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 101 2e-21 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 101 2e-21 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 101 2e-21 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 101 2e-21 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 101 2e-21 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 101 2e-21 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 101 2e-21 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 101 2e-21 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 101 2e-21 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 101 2e-21 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 101 2e-21 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 101 2e-21 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 101 2e-21 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 101 2e-21 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 101 2e-21 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 101 2e-21 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 101 2e-21 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 101 2e-21 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 101 2e-21 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 101 2e-21 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 101 2e-21 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 101 2e-21 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 101 2e-21 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 101 2e-21 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 101 2e-21 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 101 2e-21 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 101 2e-21 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 101 2e-21 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 101 2e-21 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 101 2e-21 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 101 2e-21 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 101 2e-21 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 101 2e-21 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 101 2e-21 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 101 2e-21 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 101 2e-21 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 101 2e-21 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-21 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 100 3e-21 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 100 3e-21 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 100 4e-21 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 100 4e-21 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 100 4e-21 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 100 4e-21 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 100 4e-21 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 100 4e-21 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 100 4e-21 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 100 4e-21 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 100 4e-21 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 100 4e-21 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 100 4e-21 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 100 4e-21 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 100 4e-21 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 100 4e-21 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 100 4e-21 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 100 4e-21 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 100 4e-21 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 100 4e-21 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 100 4e-21 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 100 4e-21 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 100 4e-21 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 100 4e-21 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 100 4e-21 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 100 4e-21 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 100 4e-21 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 100 4e-21 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 100 4e-21 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 100 4e-21 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 100 4e-21 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 100 4e-21 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 100 4e-21 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 100 4e-21 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 100 4e-21 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 100 4e-21 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 100 4e-21 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 100 4e-21 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 100 4e-21 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 100 4e-21 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 100 4e-21 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 100 4e-21 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 100 4e-21 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 100 4e-21 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 100 4e-21 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 100 4e-21 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 100 4e-21 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 100 4e-21 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 100 4e-21 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 100 4e-21 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 100 4e-21 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 100 4e-21 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 100 4e-21 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 100 4e-21 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 100 4e-21 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 100 4e-21 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 4e-21 >SB_45618| Best HMM Match : Ribosomal_L27e (HMM E-Value=0) Length = 168 Score = 169 bits (412), Expect = 4e-42 Identities = 79/119 (66%), Positives = 93/119 (78%), Gaps = 2/119 (1%) Frame = +1 Query: 145 GRYAGRKAIVVKNYDEGTSDKPYGHAFVAGIDRYPRKVHKRMGKNKIHKRSKIKPFVKGV 324 GRYAG+KA+++KNYD+G+SDKPYGHA VAG+ RYP KV KRMGK + KRSK+KPFVK Sbjct: 16 GRYAGKKALIIKNYDDGSSDKPYGHALVAGVARYPLKVTKRMGKKRTAKRSKVKPFVKVF 75 Query: 325 NYNHLMPTRYSVDXSFEK-FSAKDL-KDPAKRKKLRFNTRVRFEERYKSGKNKWFFQKL 495 NYNHLMPTRYSVD +K KD+ +DPA +KK + EERYKSGKNKWFFQKL Sbjct: 76 NYNHLMPTRYSVDVPLDKQVVNKDVFRDPALKKKALREVKSTLEERYKSGKNKWFFQKL 134 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 122 bits (294), Expect = 8e-28 Identities = 56/58 (96%), Positives = 56/58 (96%) Frame = +2 Query: 599 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSLRSLNGEW 772 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP LRSLNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 107 bits (258), Expect = 2e-23 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = -3 Query: 764 HSGCANCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 +SG NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 355 YSGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 107 bits (256), Expect = 3e-23 Identities = 49/51 (96%), Positives = 49/51 (96%) Frame = -3 Query: 761 SGCANCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 SG NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 81 SGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 105 bits (252), Expect = 1e-22 Identities = 49/61 (80%), Positives = 51/61 (83%), Gaps = 2/61 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRMANCKR* 789 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ C + Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCGQN 112 Query: 790 Y 792 Y Sbjct: 113 Y 113 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 105 bits (251), Expect = 1e-22 Identities = 48/59 (81%), Positives = 50/59 (84%), Gaps = 2/59 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRMANCKR 786 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ C + Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCDK 228 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 104 bits (250), Expect = 2e-22 Identities = 49/63 (77%), Positives = 52/63 (82%) Frame = +2 Query: 584 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSLRSLN 763 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIPLSPAGVIA+ LRSLN Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLN 92 Query: 764 GEW 772 GEW Sbjct: 93 GEW 95 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 104 bits (250), Expect = 2e-22 Identities = 49/59 (83%), Positives = 50/59 (84%), Gaps = 2/59 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRMANCKR 786 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ KR Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTKR 109 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 104 bits (249), Expect = 2e-22 Identities = 49/62 (79%), Positives = 51/62 (82%), Gaps = 2/62 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRMANCKR* 789 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ R Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYMRD 250 Query: 790 YF 795 Y+ Sbjct: 251 YY 252 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 104 bits (249), Expect = 2e-22 Identities = 48/59 (81%), Positives = 51/59 (86%) Frame = -3 Query: 785 RLQFAIRHSGCANCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 +L+ + NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 242 QLKKPVNREKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 223 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 891 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 378 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 227 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 294 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 34 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 270 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 243 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 268 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 452 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 121 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 287 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 137 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 196 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 588 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 224 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 502 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 393 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 103 bits (248), Expect = 3e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 609 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 186 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 103 bits (247), Expect = 4e-22 Identities = 52/72 (72%), Positives = 54/72 (75%), Gaps = 2/72 (2%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRMANCKR* 789 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR---- 81 Query: 790 YFCLKFAVXFLL 825 YF L F+L Sbjct: 82 YFLLTHLCAFVL 93 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 103 bits (246), Expect = 5e-22 Identities = 48/52 (92%), Positives = 48/52 (92%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YDSL 594 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 98.7 bits (235), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 747 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 128 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 102 bits (245), Expect = 7e-22 Identities = 51/72 (70%), Positives = 53/72 (73%), Gaps = 2/72 (2%) Frame = +1 Query: 562 SRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 741 SRG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 817 SRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 874 Query: 742 QQF--AQPEWRM 771 QQ EWR+ Sbjct: 875 QQLRSLNGEWRL 886 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 102 bits (245), Expect = 7e-22 Identities = 48/57 (84%), Positives = 49/57 (85%) Frame = -3 Query: 785 RLQFAIRHSGCANCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 615 R + R S NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 101 RKEMQERESRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 157 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 102 bits (244), Expect = 9e-22 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -3 Query: 761 SGCANCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 615 +G NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 222 TGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 102 bits (244), Expect = 9e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 612 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 533 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 102 bits (244), Expect = 9e-22 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -3 Query: 761 SGCANCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 615 +G NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 154 TGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 202 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 102 bits (244), Expect = 9e-22 Identities = 48/59 (81%), Positives = 50/59 (84%), Gaps = 2/59 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRMANCKR 786 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ +R Sbjct: 198 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRPQR 256 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 101 bits (243), Expect = 1e-21 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 2/58 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRMANCK 783 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ + Sbjct: 529 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRAR 586 >SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) Length = 1160 Score = 101 bits (243), Expect = 1e-21 Identities = 46/52 (88%), Positives = 47/52 (90%) Frame = -3 Query: 770 IRHSGCANCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 615 + S NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 849 VNSSSLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 900 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 266 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 128 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1243 Score = 66.9 bits (156), Expect = 4e-11 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 749 NCWEGRSVRASSLLRQLAKGGCAARRLSW 663 NCWEGRSVRASSLLRQLAKGGCAARRLSW Sbjct: 411 NCWEGRSVRASSLLRQLAKGGCAARRLSW 439 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 178 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 130 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 149 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 129 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 144 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1116 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 187 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 235 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 169 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 76 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 705 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 214 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 54.4 bits (125), Expect = 2e-07 Identities = 22/25 (88%), Positives = 25/25 (100%) Frame = +1 Query: 673 RLAAHPPFASWRNSEEARTDRPSQQ 747 +++AHPPFASWRNSEEARTDRPSQQ Sbjct: 14 QVSAHPPFASWRNSEEARTDRPSQQ 38 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 238 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 497 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 319 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 127 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 229 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 195 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 121 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNGEWRL 92 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 140 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 103 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 147 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 220 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 95 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 158 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 99 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 172 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 205 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 155 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 156 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 209 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 27 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 80 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 89 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 142 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 145 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 198 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 791 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 844 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 160 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 359 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 105 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 300 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 204 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 257 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 719 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 772 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 240 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 101 bits (242), Expect = 2e-21 Identities = 47/54 (87%), Positives = 48/54 (88%), Gaps = 2/54 (3%) Frame = +1 Query: 616 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQF--AQPEWRM 771 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ EWR+ Sbjct: 115 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 168 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,100,640 Number of Sequences: 59808 Number of extensions: 660219 Number of successful extensions: 8994 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5275 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8952 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5129408549 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -