BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_C02_e299_06.seq (1506 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 4.4 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 23 7.8 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.4 bits (48), Expect = 4.4 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 170 TLSRFPATLSTVNYAQSAAGVPKITFKNYEPPKEE 274 +L RF T VNY Q + KI+ PP EE Sbjct: 9 SLERF-CTYGNVNYRQRRSQPLKISCLKTTPPPEE 42 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.6 bits (46), Expect = 7.8 Identities = 7/28 (25%), Positives = 15/28 (53%) Frame = -2 Query: 149 PICHNTTKPWFTLCQILSIVVGFTLVPI 66 P CH +++ L+I+ F ++P+ Sbjct: 223 PACHTLANTFWSALYFLTIIFLFFIIPL 250 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 244,412 Number of Sequences: 336 Number of extensions: 4745 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45169425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -