BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_B11_e370_03.seq (1519 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces p... 27 6.8 SPBC19C7.05 |||cell wall organization protein |Schizosaccharomyc... 27 6.8 SPAC1D4.14 |tho2|SPAC22F3.14c|THO complex subunit Tho2 |Schizosa... 27 6.8 >SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 2280 Score = 27.1 bits (57), Expect = 6.8 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 590 IGNFGDILISHVLRRHA-VGYRFKKVGILRIYCYRVALQRK 709 + +F D L+ H +RR VG R K Y YRV+ ++K Sbjct: 1274 LSDFRDDLLEHNVRRVTIVGGRINKSAYPSYYTYRVSAEQK 1314 >SPBC19C7.05 |||cell wall organization protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 150 Score = 27.1 bits (57), Expect = 6.8 Identities = 16/63 (25%), Positives = 21/63 (33%) Frame = -2 Query: 1236 PXFFFXPXSGPPXPS*XPKXLXTXXAXXPKPX*GFVXLXPPKXXPCSPXXKASR*IXXPX 1057 P F P + PP + P+ P P PP P P + S P Sbjct: 69 PFTNFYPLTAPPPYTAEPEARYNSTIHNPMPPMSQAYRPPPTEPPTVPAYETSSEFPPPA 128 Query: 1056 YPK 1048 YP+ Sbjct: 129 YPE 131 >SPAC1D4.14 |tho2|SPAC22F3.14c|THO complex subunit Tho2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1628 Score = 27.1 bits (57), Expect = 6.8 Identities = 15/53 (28%), Positives = 21/53 (39%) Frame = -3 Query: 926 RXXXXLNTFXKTKTHSKRHSQSLSYSMTENKNKSRFSFEGGTRVLQSDIFVYF 768 R NTF H ++ LS S+ + S E +VLQ D +F Sbjct: 1007 RQTDAANTFYSRHRHDRQKIMQLSNSLQNELKEHINSLESVRKVLQGDCVKWF 1059 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,836,570 Number of Sequences: 5004 Number of extensions: 90943 Number of successful extensions: 137 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 850352646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -