SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030723E4_B10_e362_04.seq
         (1480 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK127116-1|BAC86836.1|  179|Homo sapiens protein ( Homo sapiens ...    31   8.1  

>AK127116-1|BAC86836.1|  179|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45173 fis, clone BRAWH3046196. ).
          Length = 179

 Score = 31.5 bits (68), Expect = 8.1
 Identities = 15/56 (26%), Positives = 27/56 (48%)
 Frame = -3

Query: 647 KYNFLFFTAFCMILSSISYIIHFYLEIFITIVKCCIILVIIFDMINVRDCFSSSDT 480
           +Y  LF+  FC+  +++ Y +  YL  ++ +  C I   I    IN+    +S  T
Sbjct: 70  RYVILFYVYFCLKTTNLIYNVSIYLYTYVHMYICIICAYIYSWFINIEVMANSIST 125


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 180,687,039
Number of Sequences: 237096
Number of extensions: 3480362
Number of successful extensions: 9039
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8688
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9038
length of database: 76,859,062
effective HSP length: 93
effective length of database: 54,809,134
effective search space used: 21868844466
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -