BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_B07_e338_03.seq (1545 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 27 0.37 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 23 8.0 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 27.1 bits (57), Expect = 0.37 Identities = 15/59 (25%), Positives = 26/59 (44%) Frame = -2 Query: 860 HFQHVWFTPSCVYHFCIEGL*VLPVSHRYFQWPIG*TKCASRCAPSVLQAITLKLPSLH 684 H+ V+FT V H + VL + +R+ + TK CA + ++ +LH Sbjct: 524 HYLRVFFTVFNVVHCYLASELVLMLKNRFVTLNVQLTKLTKNCATKAQSVVLGRICTLH 582 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 22.6 bits (46), Expect = 8.0 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 541 NSIDQVDEPLMFKGPQSHNLYYQEHFQRITRI 446 N +DE L + + NL+ +FQ + I Sbjct: 110 NKFQYIDEKLKTRDQKERNLFKNAYFQLVLSI 141 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 297,265 Number of Sequences: 336 Number of extensions: 6537 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 46500950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -