SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030723E4_B03_e306_03.seq
         (1631 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_10158| Best HMM Match : MMR_HSR1 (HMM E-Value=9.4e-08)              31   2.6  

>SB_10158| Best HMM Match : MMR_HSR1 (HMM E-Value=9.4e-08)
          Length = 340

 Score = 31.1 bits (67), Expect = 2.6
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = +2

Query: 44  WXXPGLQXIRHEV*MYINNIKKWVR*KINKQLYNITLN 157
           W  PGLQ   HE  +Y+N IK  +R +I+  LY I ++
Sbjct: 114 WDSPGLQDGHHEDEVYLNRIKPVLR-EIDVMLYCIKMD 150


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,226,197
Number of Sequences: 59808
Number of extensions: 509289
Number of successful extensions: 856
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 772
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 856
length of database: 16,821,457
effective HSP length: 86
effective length of database: 11,677,969
effective search space used: 5336831833
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -