BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_B02_e298_04.seq (1455 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 131 1e-30 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 64 4e-10 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 4e-08 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 57 4e-08 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 57 4e-08 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 56 9e-08 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 8e-06 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 47 3e-05 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 47 3e-05 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 45 2e-04 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 45 2e-04 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 43 5e-04 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 7e-04 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 43 7e-04 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 42 0.001 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 42 0.001 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 41 0.002 SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) 37 0.046 SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) 32 1.00 SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 32 1.3 SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) 30 5.3 SB_16469| Best HMM Match : EGF (HMM E-Value=4e-09) 29 9.3 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 9.4 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 131 bits (317), Expect = 1e-30 Identities = 63/91 (69%), Positives = 71/91 (78%) Frame = +3 Query: 102 RXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDSGTDPLDPE 281 R ITKAYRK A KWHPDNY G++KK AEK FIDIAAAKEVLTDP+KRA +D+G DPLDPE Sbjct: 222 REITKAYRKLAVKWHPDNYKGEDKKKAEKMFIDIAAAKEVLTDPEKRAKYDAGEDPLDPE 281 Query: 282 AQRAGGHGGPFNNPFHHFQHGSPFQFKFHFN 374 +Q+ GG G P H F G+ FQFKFHFN Sbjct: 282 SQQGGG-GWPQG---HGFPFGNGFQFKFHFN 308 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 63.7 bits (148), Expect = 4e-10 Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 1/84 (1%) Frame = +3 Query: 96 TSRXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDS-GTDPL 272 + + I KA+RK A K+HPD G + AE+KF ++A A EVL+D +KR +D G + L Sbjct: 38 SDKQIKKAFRKMAVKYHPDKNKGKD---AEEKFREVAEAYEVLSDENKRRQYDQFGEEGL 94 Query: 273 DPEAQRAGGHGGPFNNPFHHFQHG 344 GG G FN+ F++F HG Sbjct: 95 KNNGFGGGGGGFDFNDFFNNFGHG 118 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 56.8 bits (131), Expect = 4e-08 Identities = 36/93 (38%), Positives = 52/93 (55%), Gaps = 5/93 (5%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHG---DEKKLAEKKFIDIAAAKEVLTDPDKRAMFDSGTDPLDP 278 I KAY+K A K HPD + G ++KK+AEK+F ++ A +L+DP K+ +DSG D + Sbjct: 175 IKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSDPKKKRRYDSGQDLEE- 233 Query: 279 EAQRAGGHGGPFNNPFHHFQ--HGSPFQFKFHF 371 G+G +P FQ G P F F+F Sbjct: 234 ------GYGMDDFDPNSIFQAFFGGPGGFAFNF 260 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 56.8 bits (131), Expect = 4e-08 Identities = 36/93 (38%), Positives = 52/93 (55%), Gaps = 5/93 (5%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHG---DEKKLAEKKFIDIAAAKEVLTDPDKRAMFDSGTDPLDP 278 I KAY+K A K HPD + G ++KK+AEK+F ++ A +L+DP K+ +DSG D + Sbjct: 175 IKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSDPKKKRRYDSGQDLEE- 233 Query: 279 EAQRAGGHGGPFNNPFHHFQ--HGSPFQFKFHF 371 G+G +P FQ G P F F+F Sbjct: 234 ------GYGMDDFDPNSIFQAFFGGPGGFAFNF 260 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 56.8 bits (131), Expect = 4e-08 Identities = 36/87 (41%), Positives = 46/87 (52%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDSGTDPLDPEAQ 287 I +AYRK A K HPD D K A++KF DI AA EVL D D+R ++D + E Sbjct: 41 IKRAYRKLAMKLHPDKNKDDPK--AQEKFHDIGAAYEVLADDDQRKIYDQRGE----EGL 94 Query: 288 RAGGHGGPFNNPFHHFQHGSPFQFKFH 368 + GH ++PF F G F F H Sbjct: 95 KNAGH-RDHSDPFSSFFGGFGFHFDGH 120 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 55.6 bits (128), Expect = 9e-08 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 3/69 (4%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDS-GTDPL--DP 278 I KAYRK A K+HPD ++ AE+KF +I+ A EVL+DP K+ ++D G + L P Sbjct: 20 IKKAYRKQALKYHPDK---NKSPGAEEKFKEISEAYEVLSDPKKKEIYDQYGEEGLKGTP 76 Query: 279 EAQRAGGHG 305 Q GGHG Sbjct: 77 PPQNGGGHG 85 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 53.6 bits (123), Expect = 4e-07 Identities = 37/90 (41%), Positives = 50/90 (55%), Gaps = 5/90 (5%) Frame = +3 Query: 96 TSRXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDS-GTDPL 272 + + + KAY+K A K+HPD ++ AE+KF +IA A EVL+DP KR +FD G + L Sbjct: 16 SDQELKKAYKKQAFKYHPDK---NKDPGAEEKFKEIAEAYEVLSDPQKREIFDQYGEEGL 72 Query: 273 DPEAQRAG-GHGGPFNNP--FHHFQ-HGSP 350 G G F P F +FQ HG P Sbjct: 73 KGGVPPPGAGDADGFQMPEGFTYFQFHGDP 102 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 52.0 bits (119), Expect = 1e-06 Identities = 32/80 (40%), Positives = 46/80 (57%) Frame = +3 Query: 96 TSRXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDSGTDPLD 275 T+ I K+YRK A K+HPD + DE +F I+ A EVL+D KR ++D G + Sbjct: 77 TATEIKKSYRKLALKYHPDK-NPDEGD----RFKQISQAYEVLSDEKKRKIYDEGGE--- 128 Query: 276 PEAQRAGGHGGPFNNPFHHF 335 +A + GG GG F++P F Sbjct: 129 -DAIKGGGEGGGFHSPMDIF 147 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 49.2 bits (112), Expect = 8e-06 Identities = 26/58 (44%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +3 Query: 96 TSRXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTD-PDKRAMFDSGTD 266 T I K Y+K A KWHPD H D K+ A+K F++I A E+L+ KRA ++ TD Sbjct: 806 TQEEIKKRYKKLAMKWHPDR-HRDNKEEAQKHFMEIQEAYEILSKLKTKRASKNTRTD 862 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 47.2 bits (107), Expect = 3e-05 Identities = 30/86 (34%), Positives = 41/86 (47%) Frame = +3 Query: 96 TSRXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDSGTDPLD 275 + + I K+YRK A KWHPD + K+ AE+KF +I+ A EVL+D M G+ Sbjct: 15 SEQDIKKSYRKLALKWHPDK-NPQNKEEAERKFKEISEAYEVLSDYPFGGMAGLGSHRNG 73 Query: 276 PEAQRAGGHGGPFNNPFHHFQHGSPF 353 + G H P H F F Sbjct: 74 SDHPMRGFH-HPMRGMHHPFSFSDGF 98 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 47.2 bits (107), Expect = 3e-05 Identities = 21/49 (42%), Positives = 34/49 (69%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFD 254 + KAYR+ A +WHPD + ++ AE+KF ++ A EVL+D +KR ++D Sbjct: 20 VKKAYRRQALRWHPDK-NPTNREHAEEKFKKLSEAYEVLSDKEKRDIYD 67 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 46.4 bits (105), Expect = 6e-05 Identities = 27/71 (38%), Positives = 41/71 (57%) Frame = +3 Query: 102 RXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDSGTDPLDPE 281 + I KAY + A+K+HPD ++ K A +KF +++ A EVL+D KR +DS + Sbjct: 73 KEIKKAYFELAKKYHPDT---NKDKSASEKFQEVSEAYEVLSDDGKRKAYDS-----FGQ 124 Query: 282 AQRAGGHGGPF 314 +G GGPF Sbjct: 125 TDFSGAQGGPF 135 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 45.2 bits (102), Expect = 1e-04 Identities = 21/49 (42%), Positives = 31/49 (63%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFD 254 + K YRK A KWHPD + D + + + F +I A +VL+DP +RA +D Sbjct: 20 LKKTYRKLALKWHPDK-NLDNAEESTRVFREIQQAYDVLSDPQERAFYD 67 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 44.8 bits (101), Expect = 2e-04 Identities = 36/99 (36%), Positives = 47/99 (47%), Gaps = 9/99 (9%) Frame = +3 Query: 96 TSRXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFD------- 254 T I K YRK + K+HPD +++ AE KF A A +VL+DP KRA+++ Sbjct: 16 TDADIKKEYRKLSLKYHPDK---NQEPSAEVKFRQAAEAYDVLSDPKKRAIYNQFGEEGL 72 Query: 255 -SGTDPLDPEAQRAGGHGGPFNNPFHHFQHG-SPFQFKF 365 SG D Q HG N F F G +PF F Sbjct: 73 KSGVPEKDAWTQGYTFHGDA-NRVFREFFGGNNPFSELF 110 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 44.8 bits (101), Expect = 2e-04 Identities = 25/54 (46%), Positives = 32/54 (59%) Frame = +3 Query: 96 TSRXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDS 257 T + I KAYRK A K HPD + K A + F ++ A EVLTDP RA F++ Sbjct: 19 TEKEILKAYRKKALKCHPDKNPDNPK--ASELFHKLSKALEVLTDPKARAAFNN 70 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 43.2 bits (97), Expect = 5e-04 Identities = 23/49 (46%), Positives = 33/49 (67%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFD 254 I KAYR+ A +HPD ++ AE+KF +I+ A +VLTDP +R +FD Sbjct: 20 IKKAYRRQALIFHPDK---NKNSGAEEKFKEISEAYKVLTDPRQRDIFD 65 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 42.7 bits (96), Expect = 7e-04 Identities = 23/58 (39%), Positives = 32/58 (55%) Frame = +3 Query: 96 TSRXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDSGTDP 269 T+ I +AYR+ A K+HPD G E+ F +++ A EVL DP +R FD P Sbjct: 16 TTDDIRRAYRRLALKYHPDKNAG-----TEENFKEVSEAYEVLCDPQQRERFDKKFAP 68 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 42.7 bits (96), Expect = 7e-04 Identities = 33/81 (40%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDS-GTDPLDPEA 284 I KAYRK A++ HPD + D +KF DI A E+L+DP+KR ++D G L Sbjct: 21 IKKAYRKLAKELHPDK-NPD----TGEKFKDITFAYEILSDPEKRELYDRYGEKGL---R 72 Query: 285 QRAGGHGGPFNNPFHHFQHGS 347 + AGG G + H F GS Sbjct: 73 EGAGGGAGFEDILSHIFGGGS 93 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 42.3 bits (95), Expect = 0.001 Identities = 23/49 (46%), Positives = 32/49 (65%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFD 254 I KAYRK A++ HPD + D +KF DI A E+L+DP+KR ++D Sbjct: 21 IKKAYRKLAKELHPDK-NPD----TGEKFKDITFAYEILSDPEKRELYD 64 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 41.9 bits (94), Expect = 0.001 Identities = 28/71 (39%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDSG---TDPLDP 278 I AY K + K HPD + G +KK + F +IA A VL + + R +D G L P Sbjct: 88 IKDAYYKLSMKHHPDRHQGSDKK--HEVFQEIAEAYSVLGNLESRKQYDRGLIVEGSLAP 145 Query: 279 EAQRAGGHGGP 311 E RA HG P Sbjct: 146 EHARA-AHGPP 155 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 41.9 bits (94), Expect = 0.001 Identities = 28/71 (39%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDSG---TDPLDP 278 I AY K + K HPD + G +KK + F +IA A VL + + R +D G L P Sbjct: 88 IKDAYYKLSMKHHPDRHQGSDKK--HEVFQEIAEAYSVLGNLESRKQYDRGLIVEGSLAP 145 Query: 279 EAQRAGGHGGP 311 E RA HG P Sbjct: 146 EHARA-AHGPP 155 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 41.9 bits (94), Expect = 0.001 Identities = 21/58 (36%), Positives = 36/58 (62%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDSGTDPLDPE 281 I +AYRK + + HPD EK+ A +KF ++ + +L+D +KRA++D + +D E Sbjct: 31 IKRAYRKISLQVHPDRADKGEKEKATRKFQALSKSYCILSDKEKRAIYDESGE-IDEE 87 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/54 (40%), Positives = 30/54 (55%) Frame = +3 Query: 96 TSRXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDS 257 T I +AYR+ + + HPD D+ AE KF + A EVL D DKR +D+ Sbjct: 2495 TQAEIRRAYRRISLQLHPDRNKEDD---AELKFRKLVAVAEVLKDEDKRKRYDT 2545 >SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) Length = 445 Score = 36.7 bits (81), Expect = 0.046 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 96 TSRXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFD 254 T+ I ++K A++WHPD D + + F + A++VL D RA +D Sbjct: 300 TNEQINTEFKKKAKEWHPDKKRNDTD--SHEYFARLKKARDVLCDEKMRAKYD 350 >SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) Length = 219 Score = 32.3 bits (70), Expect = 1.00 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = +3 Query: 162 GDEKKLAEKKFIDIAAAKEVLTDPDKRAMFD 254 GD+K+ A KKF IA A E L DP++R +D Sbjct: 73 GDDKENAIKKFQLIATAYETLKDPEQRNDYD 103 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 31.9 bits (69), Expect = 1.3 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = +3 Query: 108 ITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDK 239 I + YR ++K+HPD GD +KF+ IA A E ++D +K Sbjct: 1264 IRRQYRSLSKKYHPDKETGD-----PRKFMRIAKAYEAVSDFNK 1302 >SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) Length = 340 Score = 29.9 bits (64), Expect = 5.3 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +3 Query: 93 QTSRXITKAYRKAAQKWHPDNYHGDEKKLAEKKFIDIAAAKEVLTDPDKRAMFDSGTD 266 + + + KA RK WHPD GD ++ +I A L D + RA +++ D Sbjct: 150 ELKKTLKKACRKQLLIWHPDKNGGDAEQAR-----NIIMAYSCLEDDETRARYNNQAD 202 >SB_16469| Best HMM Match : EGF (HMM E-Value=4e-09) Length = 902 Score = 29.1 bits (62), Expect = 9.3 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 508 GNVSCIDSGLNNYI*ICYLMLPGGF 434 GN SC+D G+NNY CY+ G F Sbjct: 217 GNGSCVD-GVNNYTCRCYVGYKGAF 240 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 24.2 bits (50), Expect(2) = 9.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 117 AYRKAAQKWHPDNYHGDEKKLAEKKFI 197 AYR+ +HPD + EKK K + Sbjct: 150 AYRRLCVLYHPDKHTDPEKKRVCAKLV 176 Score = 23.0 bits (47), Expect(2) = 9.4 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +3 Query: 174 KLAEKKFIDIAAAKEVLTDPDKRAMF 251 ++A + F + A EVL+DP+ +A++ Sbjct: 196 QVAVQLFSKVQKAYEVLSDPETKAIY 221 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,467,870 Number of Sequences: 59808 Number of extensions: 411905 Number of successful extensions: 737 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4683373023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -