BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_B02_e298_04.seq (1455 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752896-1|AAV30070.1| 105|Anopheles gambiae peroxidase 4A prot... 25 7.2 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 24 9.5 >AY752896-1|AAV30070.1| 105|Anopheles gambiae peroxidase 4A protein. Length = 105 Score = 24.6 bits (51), Expect = 7.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -2 Query: 542 FYSIRKIQLFQRQRIVYRFWFE*LYL 465 F RK+ + Q QRIVY W +YL Sbjct: 39 FQQARKLNIAQYQRIVYYEWLP-IYL 63 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 24.2 bits (50), Expect = 9.5 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 337 WKWWKGLLKGPPCPPARCASGSRGSVPESNIARLSG 230 W W K P P R ASG+ +V +S ++ G Sbjct: 1022 WFWDKLRFAMPHPPKVRGASGTASTVVKSGVSTAGG 1057 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 879,663 Number of Sequences: 2352 Number of extensions: 13461 Number of successful extensions: 38 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 169466715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -