BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_A12_e377_02.seq (1488 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 24 2.5 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 7.7 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 24.2 bits (50), Expect = 2.5 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +3 Query: 363 LNYSLVFVLLKVILCVQHFKKYNFNAQFKALIKHQFFFFNIE 488 +NY+LVF +LK + Q K + + + + F N++ Sbjct: 351 INYTLVFSVLKQYVMQQQVKNFRHSVRSVFFLSEIFGLVNLK 392 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.6 bits (46), Expect = 7.7 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 1433 AGXXPKXGGPXPGPXXPXPP 1374 AG + GP P P P PP Sbjct: 196 AGYGLRNYGPEPVPSTPYPP 215 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 282,810 Number of Sequences: 336 Number of extensions: 5790 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 44554875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -