BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_A11_e369_01.seq (1466 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 27 0.46 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 24 2.5 DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory pro... 23 7.5 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 22 10.0 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 26.6 bits (56), Expect = 0.46 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 232 NSKRAKKKNRPRNVQEGHKSSSVQL*ELHSVTSW 333 NS+R K+ P N SS V L +LHS+ W Sbjct: 383 NSRREGKQLNPLNKGTEADSSFVTLPQLHSLDEW 416 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 24.2 bits (50), Expect = 2.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 699 PLSPAGVIAKRPAPIALSNSCA 764 P P GV KR P AL +CA Sbjct: 52 PCPPQGVDLKRVLPEALQTNCA 73 >DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory protein 14 protein. Length = 126 Score = 22.6 bits (46), Expect = 7.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 705 SPAGVIAKRPAPIALSNSCA 764 +P G KR P AL N CA Sbjct: 54 TPEGEELKRDIPEALQNECA 73 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 22.2 bits (45), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 705 SPAGVIAKRPAPIALSNSCA 764 +P+G K+ P AL N CA Sbjct: 52 TPSGEELKKDIPDALKNECA 71 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 227,340 Number of Sequences: 336 Number of extensions: 4391 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 43837900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -