BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_A11_e369_01.seq (1466 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 118 2e-26 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 118 2e-26 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 118 2e-26 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 118 2e-26 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 118 2e-26 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 118 2e-26 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 2e-26 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 118 2e-26 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 117 2e-26 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 117 3e-26 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 117 3e-26 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 4e-26 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 4e-26 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 116 5e-26 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 116 5e-26 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 116 5e-26 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 116 5e-26 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 116 5e-26 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 116 5e-26 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 116 5e-26 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 116 5e-26 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 116 5e-26 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 116 5e-26 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 116 5e-26 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 116 5e-26 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 116 5e-26 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 116 5e-26 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 116 5e-26 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 116 5e-26 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 116 5e-26 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 116 5e-26 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 116 5e-26 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 116 5e-26 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 116 5e-26 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 116 5e-26 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 116 5e-26 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 116 5e-26 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 116 5e-26 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 116 5e-26 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 116 5e-26 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 116 5e-26 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 116 5e-26 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 116 5e-26 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 116 5e-26 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 116 5e-26 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 116 5e-26 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 116 5e-26 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 116 5e-26 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 116 5e-26 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 116 5e-26 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 116 5e-26 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 116 5e-26 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 5e-26 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 116 5e-26 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 116 5e-26 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 116 5e-26 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 116 5e-26 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 116 5e-26 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 116 5e-26 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 116 6e-26 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 116 6e-26 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 116 6e-26 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 116 6e-26 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 116 6e-26 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 116 6e-26 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 116 6e-26 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 116 6e-26 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 116 6e-26 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 116 6e-26 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 116 6e-26 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 6e-26 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 115 1e-25 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 115 1e-25 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 1e-25 SB_44936| Best HMM Match : UCR_TM (HMM E-Value=7.2) 114 1e-25 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 114 2e-25 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 114 2e-25 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 114 2e-25 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 114 2e-25 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 114 2e-25 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 114 2e-25 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 114 2e-25 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 114 2e-25 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 114 2e-25 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 114 2e-25 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 114 2e-25 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 114 2e-25 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 114 2e-25 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 114 2e-25 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 114 2e-25 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 114 2e-25 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 114 2e-25 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 114 2e-25 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 114 2e-25 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 114 2e-25 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 114 2e-25 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 114 2e-25 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 114 2e-25 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 114 2e-25 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 114 2e-25 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 114 2e-25 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 114 2e-25 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 114 2e-25 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 114 2e-25 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 114 2e-25 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 114 2e-25 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 114 2e-25 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 114 2e-25 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 114 2e-25 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 114 2e-25 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 114 2e-25 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 114 2e-25 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 114 2e-25 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 2e-25 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 114 2e-25 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 118 bits (283), Expect = 2e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 619 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 117 bits (282), Expect = 2e-26 Identities = 56/78 (71%), Positives = 61/78 (78%) Frame = +2 Query: 572 SRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPF 751 SRG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP Sbjct: 817 SRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 874 Query: 752 QQLRSLNGEWQIVSVNIL 805 QQLRSLNGEW+++ +L Sbjct: 875 QQLRSLNGEWRLMRYFLL 892 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 117 bits (281), Expect = 3e-26 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVN 799 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ N Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRQN 1120 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 117 bits (281), Expect = 3e-26 Identities = 54/59 (91%), Positives = 55/59 (93%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YDSL 604 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 114 bits (274), Expect = 2e-25 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEW 781 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 116 bits (280), Expect = 4e-26 Identities = 56/94 (59%), Positives = 61/94 (64%) Frame = +2 Query: 509 SWRQTXXXXXXXXXXXXXXXXSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRL 688 SWR + G P+ LAVVLQRRDWENPGVTQLNRL Sbjct: 23 SWRNSEEARTDRPSQQLRSLNGEGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRL 80 Query: 689 AAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 AAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 81 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 114 Score = 65.7 bits (153), Expect = 9e-11 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 683 RLAAHPPFASWRNSEEARTDRPFQQLRSLNGE 778 +++AHPPFASWRNSEEARTDRP QQLRSLNGE Sbjct: 14 QVSAHPPFASWRNSEEARTDRPSQQLRSLNGE 45 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 116 bits (280), Expect = 4e-26 Identities = 54/67 (80%), Positives = 59/67 (88%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 Query: 806 LNSR*IF 826 + IF Sbjct: 101 THLCGIF 107 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 84 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 173 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 70 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 212 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 272 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 134 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 116 bits (279), Expect = 5e-26 Identities = 52/64 (81%), Positives = 56/64 (87%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ + Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRRQVR 159 Query: 806 LNSR 817 R Sbjct: 160 AKQR 163 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 159 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 184 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 155 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 120 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 102 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 135 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 150 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 193 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 241 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 205 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 117 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 175 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 82 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 711 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 220 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 130 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 244 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 503 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 325 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 133 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 235 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 90 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 127 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 146 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 109 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 153 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 226 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 164 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 95 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 178 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 211 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 161 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 130 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 131 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 166 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 365 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 111 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 74 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 115 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 306 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 204 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 263 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 719 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 778 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 246 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 115 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 174 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 89 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 79 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 168 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 80 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 80 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 121 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 180 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 364 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 423 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 116 bits (279), Expect = 5e-26 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIVSVNIL 805 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ +L Sbjct: 437 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 496 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 83 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 186 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 200 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 1244 Score = 81.0 bits (191), Expect = 2e-15 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 780 HSPFRLRNCWKGRSVRASSLLRQLAKGGCAARRLSW 673 HSPFRLRNCW+GRSVRASSLLRQLAKGGCAARRLSW Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 439 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 131 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 90 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 224 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 101 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 86 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 115 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 196 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 245 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 95 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 97 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 116 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 96 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 100 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 80 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 110 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 156 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 210 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 27 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 81 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 89 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 143 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 98 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 145 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 199 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 791 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 845 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 84 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 107 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 89 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 529 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 583 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 65 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 198 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 252 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 105 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 27 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 81 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 116 bits (278), Expect = 6e-26 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 626 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPFQQLRSLNGEWQIV 790 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP QQLRSLNGEW+++ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 78 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,604,453 Number of Sequences: 59808 Number of extensions: 564321 Number of successful extensions: 5268 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5263 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4730324131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -