BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_A11_e369_01.seq (1466 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding pr... 26 3.2 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 5.5 >AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding protein AgamOBP17 protein. Length = 155 Score = 25.8 bits (54), Expect = 3.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 789 TICHSPFRLRNCWKGRSVRASSLLRQL 709 T+C F L CWK + + LR++ Sbjct: 121 TLCDKAFWLHKCWKQSDPKVNMALRRI 147 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.0 bits (52), Expect = 5.5 Identities = 15/55 (27%), Positives = 23/55 (41%) Frame = +3 Query: 54 LQXIGXRRLQWLQXSILAMXKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTV 218 LQ G WL +I + K K+ TFT L A +R+ + +T+ Sbjct: 769 LQSNGTCASLWLGNAIQTLNKYCAKLPSDTFTKLTPIWRCATTVRKGRKLYQYTI 823 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,015,672 Number of Sequences: 2352 Number of extensions: 19353 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 171092295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -