BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_A11_e369_01.seq (1466 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003151-13|AAK18907.1| 159|Caenorhabditis elegans Ribosomal pr... 60 4e-09 Z75525-5|CAA99764.1| 162|Caenorhabditis elegans Hypothetical pr... 30 3.6 >AF003151-13|AAK18907.1| 159|Caenorhabditis elegans Ribosomal protein, large subunitprotein 24.1 protein. Length = 159 Score = 60.1 bits (139), Expect = 4e-09 Identities = 33/80 (41%), Positives = 41/80 (51%), Gaps = 3/80 (3%) Frame = +3 Query: 114 KTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKK---GQEEEXXXXXXXXX 284 K +V+ DGK FL+ K +RRNPR + WTVLYR K KK GQE+ Sbjct: 19 KRLVRTDGKVQIFLSGKALKGAKLRRNPRDIRWTVLYRIKNKKGTHGQEQVTRKKTKKSV 78 Query: 285 XXXXXXIVGASLSDIMAKRN 344 + G SL I+AKRN Sbjct: 79 QVVNRAVAGLSLDAILAKRN 98 >Z75525-5|CAA99764.1| 162|Caenorhabditis elegans Hypothetical protein C03D6.8 protein. Length = 162 Score = 30.3 bits (65), Expect = 3.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 123 VKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRR 230 V+ D F F S+C ++NPRK+ +T RR Sbjct: 22 VRNDSTVFKFCRSRCNKLFKKKKNPRKLRFTKAARR 57 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,228,237 Number of Sequences: 27780 Number of extensions: 412599 Number of successful extensions: 759 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 757 length of database: 12,740,198 effective HSP length: 84 effective length of database: 10,406,678 effective search space used: 4204297912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -