BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_A09_e353_01.seq (1506 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19A8.01c |sec73|sec7c, SPAC23H3.01|guanyl-nucleotide exchang... 28 3.9 SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pomb... 27 5.1 >SPAC19A8.01c |sec73|sec7c, SPAC23H3.01|guanyl-nucleotide exchange factor Sec73 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1082 Score = 27.9 bits (59), Expect = 3.9 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +1 Query: 199 LGITPSSFTITNYLNL*RGKVSYKLLSIDG 288 LG++P +FT+ N LN+ R ++S LS DG Sbjct: 532 LGLSPYTFTLENQLNISRPEIS---LSYDG 558 >SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1428 Score = 27.5 bits (58), Expect = 5.1 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -1 Query: 612 KRRFCSVICYNTNKCKRFF*SGNSVYHKTNILYDS 508 + R+ + NTNKCK F SGN DS Sbjct: 710 RSRYMGIQAINTNKCKLAFLSGNLPVSYVRFFMDS 744 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,012,349 Number of Sequences: 5004 Number of extensions: 95541 Number of successful extensions: 152 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 842423950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -