BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030723E4_A06_e329_02.seq (1516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 3.4 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 23 7.8 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 23 7.8 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 23 7.8 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.8 bits (49), Expect = 3.4 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +1 Query: 715 YGGNGRPGFSDKYGVSNSNYQFSQSGGIYGGEVNYXTKPPS 837 + GNG+ G SD S N Q + + T PP+ Sbjct: 397 HNGNGKKGSSDSCSDSEENSQSDITNNVNSPASMNQTPPPT 437 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.6 bits (46), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 632 EDLPERTDPLNPCYTLQDHKKFL 700 E L + DP++ T+QDH+ L Sbjct: 5 ETLWKMKDPMSASETVQDHRNLL 27 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.6 bits (46), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 632 EDLPERTDPLNPCYTLQDHKKFL 700 E L + DP++ T+QDH+ L Sbjct: 5 ETLWKMKDPMSASETVQDHRNLL 27 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 22.6 bits (46), Expect = 7.8 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +2 Query: 518 AMTRKLKKNEHMCLLMILYMPSPSISNLSANQ*LQF 625 A+ LKK + ++IL + + +I + ++N+ LQF Sbjct: 5 AINHSLKKRLKIITIVILVVATGNIIHTTSNKQLQF 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 279,457 Number of Sequences: 336 Number of extensions: 5577 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45476700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -