Samia BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030723E4_A05_e321_01.seq
         (1441 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC31G5.13 |rpn11|pad1, sks1, bfr2, mts5|19S proteasome regulat...    28   3.7  

>SPAC31G5.13 |rpn11|pad1, sks1, bfr2, mts5|19S proteasome regulatory
           subunit Rpn11|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 308

 Score = 27.9 bits (59), Expect = 3.7
 Identities = 18/56 (32%), Positives = 26/56 (46%)
 Frame = +2

Query: 206 RRTATTSGVPPDIRIHTYIHELYRYIFTRAYN*QVNSLETSLLQNLHESFLCTGLL 373
           R+T +  G      I   IH L R+ ++   N +   LE  +L NLH+     GLL
Sbjct: 174 RQTTSNLGHINKPSIQALIHGLGRHYYSLRINYKKTELEEIMLLNLHKQPWAHGLL 229


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,566,175
Number of Sequences: 5004
Number of extensions: 62011
Number of successful extensions: 114
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 113
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 114
length of database: 2,362,478
effective HSP length: 75
effective length of database: 1,987,178
effective search space used: 802819912
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)